DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ young-2007-1 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Young DW., Hassan MQ., Pratap J., Galindo M., Zaidi SK., Lee SH., Yang X., Xie R., Javed A., Underwood JM., Furcinitti P., Imbalzano AN., Penman S., Nickerson JA., Montecino MA., Lian JB., Stein JL., van Wijnen AJ., Stein GS. DIP original experiment: DIP-253241X Nature 2007 IMEx Mitotic occupancy and lineage-specific transcriptional control of rRNA genes by Runx2. Young DW., Hassan MQ., Pratap J., Galindo M., Zaidi SK., Lee SH., Yang X., Xie R., Javed A., Underwood JM., Furcinitti P., Imbalzano AN., Penman S., Nickerson JA., Montecino MA., Lian JB., Stein JL., van Wijnen AJ., Stein GS. Only protein-protein interactions imex curation young-2007-2 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Young DW., Hassan MQ., Pratap J., Galindo M., Zaidi SK., Lee SH., Yang X., Xie R., Javed A., Underwood JM., Furcinitti P., Imbalzano AN., Penman S., Nickerson JA., Montecino MA., Lian JB., Stein JL., van Wijnen AJ., Stein GS. DIP original experiment: DIP-253244X Nature 2007 IMEx Mitotic occupancy and lineage-specific transcriptional control of rRNA genes by Runx2. Young DW., Hassan MQ., Pratap J., Galindo M., Zaidi SK., Lee SH., Yang X., Xie R., Javed A., Underwood JM., Furcinitti P., Imbalzano AN., Penman S., Nickerson JA., Montecino MA., Lian JB., Stein JL., van Wijnen AJ., Stein GS. Only protein-protein interactions imex curation young-2007-3 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Young DW., Hassan MQ., Pratap J., Galindo M., Zaidi SK., Lee SH., Yang X., Xie R., Javed A., Underwood JM., Furcinitti P., Imbalzano AN., Penman S., Nickerson JA., Montecino MA., Lian JB., Stein JL., van Wijnen AJ., Stein GS. DIP original experiment: DIP-253239X Nature 2007 IMEx Mitotic occupancy and lineage-specific transcriptional control of rRNA genes by Runx2. Young DW., Hassan MQ., Pratap J., Galindo M., Zaidi SK., Lee SH., Yang X., Xie R., Javed A., Underwood JM., Furcinitti P., Imbalzano AN., Penman S., Nickerson JA., Montecino MA., Lian JB., Stein JL., van Wijnen AJ., Stein GS. Only protein-protein interactions imex curation young-2007-4 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Young DW., Hassan MQ., Pratap J., Galindo M., Zaidi SK., Lee SH., Yang X., Xie R., Javed A., Underwood JM., Furcinitti P., Imbalzano AN., Penman S., Nickerson JA., Montecino MA., Lian JB., Stein JL., van Wijnen AJ., Stein GS. DIP original experiment: DIP-253242X Nature 2007 IMEx Mitotic occupancy and lineage-specific transcriptional control of rRNA genes by Runx2. Young DW., Hassan MQ., Pratap J., Galindo M., Zaidi SK., Lee SH., Yang X., Xie R., Javed A., Underwood JM., Furcinitti P., Imbalzano AN., Penman S., Nickerson JA., Montecino MA., Lian JB., Stein JL., van Wijnen AJ., Stein GS. Only protein-protein interactions imex curation young-2007-5 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Young DW., Hassan MQ., Pratap J., Galindo M., Zaidi SK., Lee SH., Yang X., Xie R., Javed A., Underwood JM., Furcinitti P., Imbalzano AN., Penman S., Nickerson JA., Montecino MA., Lian JB., Stein JL., van Wijnen AJ., Stein GS. DIP original experiment: DIP-253240X Nature 2007 IMEx Mitotic occupancy and lineage-specific transcriptional control of rRNA genes by Runx2. Young DW., Hassan MQ., Pratap J., Galindo M., Zaidi SK., Lee SH., Yang X., Xie R., Javed A., Underwood JM., Furcinitti P., Imbalzano AN., Penman S., Nickerson JA., Montecino MA., Lian JB., Stein JL., van Wijnen AJ., Stein GS. Only protein-protein interactions imex curation young-2007-6 rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Young DW., Hassan MQ., Pratap J., Galindo M., Zaidi SK., Lee SH., Yang X., Xie R., Javed A., Underwood JM., Furcinitti P., Imbalzano AN., Penman S., Nickerson JA., Montecino MA., Lian JB., Stein JL., van Wijnen AJ., Stein GS. DIP original experiment: DIP-253245X Nature 2007 IMEx Mitotic occupancy and lineage-specific transcriptional control of rRNA genes by Runx2. Young DW., Hassan MQ., Pratap J., Galindo M., Zaidi SK., Lee SH., Yang X., Xie R., Javed A., Underwood JM., Furcinitti P., Imbalzano AN., Penman S., Nickerson JA., Montecino MA., Lian JB., Stein JL., van Wijnen AJ., Stein GS. Only protein-protein interactions imex curation young-2007-7 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Young DW., Hassan MQ., Pratap J., Galindo M., Zaidi SK., Lee SH., Yang X., Xie R., Javed A., Underwood JM., Furcinitti P., Imbalzano AN., Penman S., Nickerson JA., Montecino MA., Lian JB., Stein JL., van Wijnen AJ., Stein GS. DIP original experiment: DIP-253243X Nature 2007 IMEx Mitotic occupancy and lineage-specific transcriptional control of rRNA genes by Runx2. Young DW., Hassan MQ., Pratap J., Galindo M., Zaidi SK., Lee SH., Yang X., Xie R., Javed A., Underwood JM., Furcinitti P., Imbalzano AN., Penman S., Nickerson JA., Montecino MA., Lian JB., Stein JL., van Wijnen AJ., Stein GS. Only protein-protein interactions imex curation young-2007-8 rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Young DW., Hassan MQ., Pratap J., Galindo M., Zaidi SK., Lee SH., Yang X., Xie R., Javed A., Underwood JM., Furcinitti P., Imbalzano AN., Penman S., Nickerson JA., Montecino MA., Lian JB., Stein JL., van Wijnen AJ., Stein GS. DIP original experiment: DIP-253246X Nature 2007 IMEx Mitotic occupancy and lineage-specific transcriptional control of rRNA genes by Runx2. Young DW., Hassan MQ., Pratap J., Galindo M., Zaidi SK., Lee SH., Yang X., Xie R., Javed A., Underwood JM., Furcinitti P., Imbalzano AN., Penman S., Nickerson JA., Montecino MA., Lian JB., Stein JL., van Wijnen AJ., Stein GS. Only protein-protein interactions imex curation ubf1_mouse Nucleolar transcription factor 1 Ubtf Tcfubf Ubf1 Ubf-1 Upstream-binding factor 1 protein protein mouse Mus musculus Mouse MNGEADCPTDLEMAAPKGQDRWSQEDMLTLLECMKNNLPSNDSSKFKTTESHMDWEKVAFKDFSGDMCKLKWVEISNEVRKFRTLTELILDAQEHVKNPYKGKKLKKHPDFPKKPLTPYFRFFMEKRAKYAKLHPEMSNLDLTKILSKKYKELPEKKKMKYIQDFQREKQEFERNLARFREDHPDLIQNAKKSDIPEKPKTPQQLWYTHEKKVYLKVRPDATTKEVKDSLGKQWSQLSDKKTLKWIHKALEQRKEYEEIMRDYIQKHPELNISEEGITKSTLTKAERQLKDKFDGRPTKPPPNSYSLYCAELMANMKDVPSTERMVLCSQQWKLLSQKEKDAYHKKCDQKKKDYEVELLRFLESLPEEEQQRVLGEEKMLNINKKQTTSPASKKPSQEGGKGGSEKPKRPVSAMFIFSEEKRRQLQEERPELSESELTRLLARMWNDLTEKKKAKYKAREAALKAQSERKPGGEREDRGKLPESPKRAEEIWQQSVIGDYLARFKNDRVKALKAMEMTWNNMEKKEKLMWIKKAAEDQKRYERELSEMRAPPAATNSSKKMKFQGEPKKPPMNGYQKFSQELLSNGELNHLPLKERMVEIGSRWQRISQSQKEHYKKLAEEQQRQYKVHLDLWVKSLSPQDRAAYKEYISNKRKNMTKLRGPNPKSSRTTLQSKSESEEDDDEEEEDDEEEEEEEEDDENGDSSEDGGDSSESSSEDESEDGDENDDDDDDEDDEDDDDEDEDNESEGSSSSSSSSGDSSDSGSN mint UBF recognizes the ribosomal RNA gene promoter and activates transcription mediated by RNA polymerase I through cooperative interactions with the species-specific factor SL1. It binds specifically to the upstream control element runx2_mouse Runt-related transcription factor 2 Runx2 Aml3 Cbfa1 Osf2 Pebp2a Core-binding factor subunit alpha-1 Acute myeloid leukemia 3 protein Oncogene AML-3 Polyomavirus enhancer-binding protein 2 alpha A subunit SL3-3 enhancer factor 1 alpha A subunit SL3/AKV core-binding factor alpha A subunit Osteoblast-specific transcription factor 2 protein protein mouse Mus musculus Mouse MLHSPHKQPQNHKCGANFLQEDCKKALAFKWLISAGHYQPPRPTESVSALTTVHAGIFKAASSIYNRGHKFYLEKKGGTMASNSLFSAVTPCQQSFFWDPSTSRRFSPPSSSLQPGKMSDVSPVVAAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQEAAAAAAAAAAAAAAAAAAVPRLRPPHDNRTMVEIIADHPAELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGEVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKVTVDGPREPRRHRQKLDDSKPSLFSDRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSSLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRMHYPATFTYTPPVTSGMSLGMSATTHYHTYLPPPYPGSSQSQSGPFQTSSTPYLYYGTSSASYQFPMVPGGDRSPSRMVPPCTTTSNGSTLLNPNLPNQNDGVDADGSHSSSPTVLNSSGRMDESVWRPY runx2_human Runt-related transcription factor 2 Oncogene AML-3 Polyomavirus enhancer-binding protein 2 alpha A subunit SL3-3 enhancer factor 1 alpha A subunit SL3/AKV core-binding factor alpha A subunit Osteoblast-specific transcription factor 2 Core-binding factor subunit alpha-1 Acute myeloid leukemia 3 protein RUNX2 AML3 CBFA1 OSF2 PEBP2A protein protein human Homo sapiens Human MASNSLFSTVTPCQQNFFWDPSTSRRFSPPSSSLQPGKMSDVSPVVAAQQQQQQQQQQQQQQQQQQQQQQQEAAAAAAAAAAAAAAAAAVPRLRPPHDNRTMVEIIADHPAELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGEVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKVTVDGPREPRRHRQKLDDSKPSLFSDRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRMHYPATFTYTPPVTSGMSLGMSATTHYHTYLPPPYPGSSQSQSGPFQTSSTPYLYYGTSSGSYQFPMVPGGDRSPSRMLPPCTTTSNGSTLLNPNLPNQNDGVDADGSHSSSPTVLNSSGRMDESVWRPY ubf1_human Nucleolar transcription factor 1 UBTF UBF UBF1 Upstream-binding factor 1 Autoantigen NOR-90 protein protein human Homo sapiens Human MNGEADCPTDLEMAAPKGQDRWSQEDMLTLLECMKNNLPSNDSSKFKTTESHMDWEKVAFKDFSGDMCKLKWVEISNEVRKFRTLTELILDAQEHVKNPYKGKKLKKHPDFPKKPLTPYFRFFMEKRAKYAKLHPEMSNLDLTKILSKKYKELPEKKKMKYIQDFQREKQEFERNLARFREDHPDLIQNAKKSDIPEKPKTPQQLWYTHEKKVYLKVRPDATTKEVKDSLGKQWSQLSDKKRLKWIHKALEQRKEYEEIMRDYIQKHPELNISEEGITKSTLTKAERQLKDKFDGRPTKPPPNSYSLYCAELMANMKDVPSTERMVLCSQQWKLLSQKEKDAYHKKCDQKKKDYEVELLRFLESLPEEEQQRVLGEEKMLNINKKQATSPASKKPAQEGGKGGSEKPKRPVSAMFIFSEEKRRQLQEERPELSESELTRLLARMWNDLSEKKKAKYKAREAALKAQSERKPGGEREERGKLPESPKRAEEIWQQSVIGDYLARFKNDRVKALKAMEMTWNNMEKKEKLMWIKKAAEDQKRYERELSEMRAPPAATNSSKKMKFQGEPKKPPMNGYQKFSQELLSNGELNHLPLKERMVEIGSRWQRISQSQKEHYKKLAEEQQKQYKVHLDLWVKSLSPQDRAAYKEYISNKRKSMTKLRGPNPKSSRTTLQSKSESEEDDEEDEDDEDEDEEEEDDENGDSSEDGGDSSESSSEDESEDGDENEEDDEDEDDDEDDDEDEDNESEGSSSSSSSSGDSSDSDSN taf1a_mouse TATA box-binding protein-associated factor RNA polymerase I subunit A Taf1a RNA polymerase I-specific TBP-associated factor 48 kDa TATA box-binding protein-associated factor 1A Transcription initiation factor SL1/TIF-IB subunit A protein protein mouse Mus musculus Mouse MMSDFGEELTKLAVAEDNPETSVLSKTGMHFPWLHKHVEAVVTGGKKRKDFAQTTSACLSFIQEALLKHQWQQAAEYMHSYLQTLEDSDTDKRQAAPEIIWKLGSEILFYHPKSNVETFNSFADRMKNIGVLNYLKISLQHALYLLHHGMLDDANRNLSKAETWRYGEKSSSQEVLINLVQAYKGLLQYYTWTRKKMELSKLDEDDYAYAAKTRTMLSQSCKTSTNICALVKTPGVWDPFVKSYVEMLEFYGDQDGAREMLTNYAYDEKFPSNPNAHVYLYEFLKREKAPRAKLISVLKILHEIVPSHTLMLEFHTLLRKSDTEEHQKLGLSVLFEVLDFAGCNKNITAWKYLAKYLKQILVGSHHEWVEEEWKSRRNWWPAFHFSFFWAKSDWKADTDLACEKAFVAGVLLGKGCKYFRYILKQDHETLKKKIKRMKKSVKKYTIVNPGVHT runx2_rat Runt-related transcription factor 2 Runx2 Cbfa1 Osf2 Core-binding factor subunit alpha-1 Osteoblast-specific transcription factor 2 protein protein rat Rattus norvegicus (Rat) Rat MLHSPHKQPQNHKCGANFLQEDSKEALVFKWLISAGHYQPPRPTESVSALSTVHAVIFKAASSIYNRGHKFYLEKKGGTMASNSLFSAVTPCQQSFFWNKTLPVAFKVVALGEVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKVTVDGPREPRRHRQKLDDSKPSLFSDRLSDLGRI ubf1_rat Nucleolar transcription factor 1 Ubtf Tcfubf Ubf-1 Upstream-binding factor 1 protein protein rat Rattus norvegicus (Rat) Rat MNGEADCPTDLEMAAPKGQDRWSQEDMLTLLECMKNNLPSNDSSKFKTTESHMDWEKVAFKDFSGDMCKLKWVEISNEVRKFRTLTELILDAQEHVKNPYKGKKLKKHPDFPKKPLTPYFRFFMEKRAKYAKLHPEMSNLDLTKILSKKYKELPEKKKMKYIQDFQREKQEFERNLARFREDHPDLIQNAKKSDIPEKPKTPQQLWYTHEKKVYLKVRPDATTKEVKDSLGKQWSQLSDKKRLKWIHKALEQRKEYEEIMRDYIQKHPELNISEEGITKSTLTKAERQLKDKFDGRPTKPPPNSYSLYCAELMANMKDVPSTERMVLCSQQWKLLSQKEKDAYHKKCDQKKKDYEVELLRFLESLPEEEQQRVLGEEKMLNINKKQTTSPASKKPSQEGGKGGSEKPKRPVSAMFIFSEEKRRQLQEERPELSESELTRLLARMWNDLSEKKKAKYKAREAALKAQSERKPGGEREDRGKLPESPKRAEEIWQQSVIGDYLARFKNDRVKALKAMEMTWNNMEKKEKLMWIKKAAEDQKRYERELSEMRAPPAATNSSKKMKFQGEPKKPPMNGYQKFSQELLSNGELNHLPLKERMVEIGSRWQRISQSQKEHYKKLAEEQQRQYKVHLDLWVKSLSPQDRAAYKEYISNKRKNMTKLRGPNPKSSRTTLQSKSESEEDDDEEDDDDDDEEEEEDDENGDSSEDGGDSSESSSEDESEDGDENEDDDDDEDDDEDDDEDEDNESEGSSSSSSSSGDSSDSDSN ubtf-runx2-1 3152304 N/A 3152312 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3152313 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association false false false runx2-ubtf-1 3152305 N/A 3152314 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3152315 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false ubtf-runx2-2 3152306 N/A 3152312 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3152316 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3152313 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association false false false runx2-ubtf-2 3152307 N/A 3152312 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3152313 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association false false false runx2-taf1a-1 3152308 N/A 3152312 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3152316 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3152313 unspecified role unspecified role bait bait mouse Mus musculus Mouse association association false false false ubtf-runx2-3 3152309 N/A 3152317 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat N/A 3152318 unspecified role unspecified role bait bait rat Rattus norvegicus (Rat) Rat physical association physical association false false false ubtf-runx2-4 3152310 N/A 3152314 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3152315 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false runx2-ubtf-3 3152311 N/A 3152317 unspecified role unspecified role bait bait rat Rattus norvegicus (Rat) Rat N/A 3152318 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat physical association physical association false false false