DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ bhattacharya-2007-1 ecolx Escherichia coli sls static light scattering sls predetermined predetermined participant predetermined Bhattacharya S., Takada S., Jacobson RH. DIP original experiment: DIP-260598X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural analysis and dimerization potential of the human TAF5 subunit of TFIID. Bhattacharya S., Takada S., Jacobson RH. Only protein-protein interactions imex curation bhattacharya-2007-2 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Bhattacharya S., Takada S., Jacobson RH. DIP original experiment: DIP-260595X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural analysis and dimerization potential of the human TAF5 subunit of TFIID. Bhattacharya S., Takada S., Jacobson RH. Only protein-protein interactions imex curation bhattacharya-2007-3 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Bhattacharya S., Takada S., Jacobson RH. DIP original experiment: DIP-260596X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural analysis and dimerization potential of the human TAF5 subunit of TFIID. Bhattacharya S., Takada S., Jacobson RH. Only protein-protein interactions imex curation bhattacharya-2007-4 ecolx Escherichia coli dls dynamic light scattering dls predetermined predetermined participant predetermined Bhattacharya S., Takada S., Jacobson RH. DIP original experiment: DIP-260597X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural analysis and dimerization potential of the human TAF5 subunit of TFIID. Bhattacharya S., Takada S., Jacobson RH. Only protein-protein interactions imex curation taf5_human Transcription initiation factor TFIID subunit 5 Transcription initiation factor TFIID 100 kDa subunit TAF5 TAF2D protein protein human Homo sapiens Human MAALAEEQTEVAVKLEPEGPPTLLPPQAGDGAGEGSGGTTNNGPNGGGGNVAASSSTGGDGGTPKPTVAVSAAAPAGAAPVPAAAPDAGAPHDRQTLLAVLQFLRQSKLREAEEALRREAGLLEEAVAGSGAPGEVDSAGAEVTSALLSRVTASAPGPAAPDPPGTGASGATVVSGSASGPAAPGKVGSVAVEDQPDVSAVLSAYNQQGDPTMYEEYYSGLKHFIECSLDCHRAELSQLFYPLFVHMYLELVYNQHENEAKSFFEKFHGDQECYYQDDLRVLSSLTKKEHMKGNETMLDFRTSKFVLRISRDSYQLLKRHLQEKQNNQIWNIVQEHLYIDIFDGMPRSKQQIDAMVGSLAGEAKREANKSKVFFGLLKEPEIEVPLDDEDEEGENEEGKPKKKKPKKDSIGSKSKKQDPNAPPQNRIPLPELKDSDKLDKIMNMKETTKRVRLGPDCLPSICFYTFLNAYQGLTAVDVTDDSSLIAGGFADSTVRVWSVTPKKLRSVKQASDLSLIDKESDDVLERIMDEKTASELKILYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNSNYVATGSADRTVRLWDVLNGNCVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRFSRDGEILASGSMDNTVRLWDAIKAFEDLETDDFTTATGHINLPENSQELLLGTYMTKSTPVVHLHFTRRNLVLAAGAYSPQ taf5-1 3152161 N/A 3152165 unspecified role unspecified role unspecified role unspecified role Region 189-343 Region 189-343 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false taf5-2 3152162 N/A 3152165 unspecified role unspecified role unspecified role unspecified role Region 189-343 Region 189-343 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false taf5-3 3152163 N/A 3152165 unspecified role unspecified role unspecified role unspecified role Region 189-343 Region 189-343 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false taf5-4 3152164 N/A 3152165 unspecified role unspecified role unspecified role unspecified role Region 189-343 Region 189-343 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false