DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ larsen-2007-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Larsen NA., Al-Bassam J., Wei RR., Harrison SC. DIP original experiment: DIP-260587X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural analysis of Bub3 interactions in the mitotic spindle checkpoint. Larsen NA., Al-Bassam J., Wei RR., Harrison SC. Only protein-protein interactions imex curation larsen-2007-2 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Larsen NA., Al-Bassam J., Wei RR., Harrison SC. DIP original experiment: DIP-260582X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural analysis of Bub3 interactions in the mitotic spindle checkpoint. Larsen NA., Al-Bassam J., Wei RR., Harrison SC. Only protein-protein interactions imex curation larsen-2007-3 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Larsen NA., Al-Bassam J., Wei RR., Harrison SC. DIP original experiment: DIP-260585X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural analysis of Bub3 interactions in the mitotic spindle checkpoint. Larsen NA., Al-Bassam J., Wei RR., Harrison SC. Only protein-protein interactions imex curation larsen-2007-4 ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Larsen NA., Al-Bassam J., Wei RR., Harrison SC. DIP original experiment: DIP-260583X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural analysis of Bub3 interactions in the mitotic spindle checkpoint. Larsen NA., Al-Bassam J., Wei RR., Harrison SC. Only protein-protein interactions imex curation larsen-2007-5 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Larsen NA., Al-Bassam J., Wei RR., Harrison SC. DIP original experiment: DIP-260586X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural analysis of Bub3 interactions in the mitotic spindle checkpoint. Larsen NA., Al-Bassam J., Wei RR., Harrison SC. Only protein-protein interactions imex curation larsen-2007-6 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Larsen NA., Al-Bassam J., Wei RR., Harrison SC. DIP original experiment: DIP-260588X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural analysis of Bub3 interactions in the mitotic spindle checkpoint. Larsen NA., Al-Bassam J., Wei RR., Harrison SC. Only protein-protein interactions imex curation larsen-2007-7 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Larsen NA., Al-Bassam J., Wei RR., Harrison SC. DIP original experiment: DIP-260584X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structural analysis of Bub3 interactions in the mitotic spindle checkpoint. Larsen NA., Al-Bassam J., Wei RR., Harrison SC. Only protein-protein interactions imex curation bub1_yeast Checkpoint serine/threonine-protein kinase BUB1 YGR188C G7542 BUB1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNLDLGSTVRGYESDKDTFPQSKGVSSSQKEQHSQLNQTKIAYEQRLLNDLEDMDDPLDLFLDYMIWISTSYIEVDSESGQEVLRSTMERCLIYIQDMETYRNDPRFLKIWIWYINLFLSNNFHESENTFKYMFNKGIGTKLSLFYEEFSKLLENAQFFLEAKVLLELGAENNCRPYNRLLRSLSNYEDRLREMNIVENQNSVPDSRERLKGRLIYRTAPFFIRKFLTSSLMTDDKENRANLNSNVGVGKSAPNVYQDSIVVADFKSETERLNLNSSKQPSNQRLKNGNKKTSIYADQKQSNNPVYKLINTPGRKPERIVFNFNLIYPENDEEFNTEEILAMIKGLYKVQRRGKKHTEDYTSDKNRKKRKLDVLVERRQDLPSSQPPVVPKSTRIEVFKDDDNPSQSTHHKNTQVQVQTTTSILPLKPVVDGNLAHETPVKPSLTSNASRSPTVTAFSKDAINEVFSMFNQHYSTPGALLDGDDTTTSKFNVFENFTQEFTAKNIEDLTEVKDPKQETVSQQTTSTNETNDRYERLSNSSTRPEKADYMTPIKETTETDVVPIIQTPKEQIRTEDKKSGDNTETQTQLTSTTIQSSPFLTQPEPQAEKLLQTAEHSEKSKEHYPTIIPPFTKIKNQPPVIIENPLSNNLRAKFLSEISPPLFQYNTFYNYNQELKMSSLLKKIHRVSRNENKNPIVDFKKTGDLYCIRGELGEGGYATVYLAESSQGHLRALKVEKPASVWEYYIMSQVEFRLRKSTILKSIINASALHLFLDESYLVLNYASQGTVLDLINLQREKAIDGNGIMDEYLCMFITVELMKVLEKIHEVGIIHGDLKPDNCMIRLEKPGEPLGAHYMRNGEDGWENKGIYLIDFGRSFDMTLLPPGTKFKSNWKADQQDCWEMRAGKPWSYEADYYGLAGVIHSMLFGKFIETIQLQNGRCKLKNPFKRYWKKEIWGVIFDLLLNSGQASNQALPMTEKIVEIRNLIESHLEQHAENHLRNVILSIEEELSHFQYKGKPSRRF 6D76FC980775D3F9 bub3_yeast Cell cycle arrest protein BUB3 OR26.16 YOR026W BUB3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MQIVQIEQAPKDYISDIKIIPSKSLLLITSWDGSLTVYKFDIQAKNVDLLQSLRYKHPLLCCNFIDNTDLQIYVGTVQGEILKVDLIGSPSFQALTNNEANLGICRICKYGDDKLIAASWDGLIEVIDPRNYGDGVIAVKNLNSNNTKVKNKIFTMDTNSSRLIVGMNNSQVQWFRLPLCEDDNGTIEESGLKYQIRDVALLPKEQEGYACSSIDGRVAVEFFDDQGDDYNSSKRFAFRCHRLNLKDTNLAYPVNSIEFSPRHKFLYTAGSDGIISCWNLQTRKKIKNFAKFNEDSVVKIACSDNILCLATSDDTFKTNAAIDQTIELNASSIYIIFDYEN 0BDFB8697935BCEB mad3_yeast Spindle assembly checkpoint component MAD3 MAD3 YJL013C J1341 Mitotic MAD3 protein protein protein yeast Saccharomyces cerevisiae Baker's yeast MKAYAKKRISYMPSSPSQNVINFEEIETQKENILPLKEGRSAAALSKAIHQPLVEINQVKSSFEQRLIDELPALSDPITLYLEYIKWLNNAYPQGGNSKQSGMLTLLERCLSHLKDLERYRNDVRFLKIWFWYIELFTRNSFMESRDIFMYMLRNGIGSELASFYEEFTNLLIQKEKFQYAVKILQLGIKNKARPNKVLEDRLNHLLRELGENNIQLGNEISMDSLESTVLGKTRSEFVNRLELANQNGTSSDVNLTKNNVFVDGEESDVELFETPNRGVYRDGWENFDLKAERNKENNLRISLLEANTNLGELKQHEMLSQKKRPYDEKLPIFRDSIGRSDPVYQMINTKDQKPEKIDCNFKLIYCEDEESKGGRLEFSLEEVLAISRNVYKRVRTNRKHPREANLGQEESANQKEAEAQSKRPKISRKALVSKSLTPSNQGRMFSGEEYINCPMTPKGRSTETSDIISAVKPRQLTPILEMRESNSFSQSKNSEIISDDDKSSSSFISYPPQR 36550249D81BB6D1 bub1-bub3-5 3152094 N/A 3152101 unspecified role unspecified role unspecified role unspecified role Region 315-356 Region 315-356 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3152102 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false bub3-mad3-6 3152095 N/A 3152102 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3152103 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false bub1-bub3-6 3152096 N/A 3152101 unspecified role unspecified role unspecified role unspecified role Region 315-356 Region 315-356 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3152102 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false bub3-mad3-7 3152097 N/A 3152102 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3152103 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false bub3-mad3-8 3152098 N/A 3152102 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3152103 unspecified role unspecified role unspecified role unspecified role Region 354-401 Region 354-401 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false bub3-mad3-9 3152099 N/A 3152102 unspecified role unspecified role unspecified role unspecified role P26449:p.Arg197Glu R197E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3152103 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false bub3-mad3-10 3152100 N/A 3152102 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3152103 unspecified role unspecified role unspecified role unspecified role Region 354-401 Region 354-401 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false