DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ stevenson-2007-2 in vitro In vitro protease assay protease assay autoradiography autoradiography Stevenson LG., Strisovsky K., Clemmer KM., Bhatt S., Freeman M., Rather PN. DIP original experiment: DIP-260578X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Rhomboid protease AarA mediates quorum-sensing in Providencia stuartii by activating TatA of the twin-arginine translocase. Stevenson LG., Strisovsky K., Clemmer KM., Bhatt S., Freeman M., Rather PN. Only protein-protein interactions imex curation stevenson-2007-3 in vitro In vitro protease assay protease assay autoradiography autoradiography Stevenson LG., Strisovsky K., Clemmer KM., Bhatt S., Freeman M., Rather PN. DIP original experiment: DIP-260579X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Rhomboid protease AarA mediates quorum-sensing in Providencia stuartii by activating TatA of the twin-arginine translocase. Stevenson LG., Strisovsky K., Clemmer KM., Bhatt S., Freeman M., Rather PN. Only protein-protein interactions imex curation stevenson-2007-4 in vitro In vitro protease assay protease assay predetermined predetermined participant predetermined Stevenson LG., Strisovsky K., Clemmer KM., Bhatt S., Freeman M., Rather PN. DIP original experiment: DIP-260580X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Rhomboid protease AarA mediates quorum-sensing in Providencia stuartii by activating TatA of the twin-arginine translocase. Stevenson LG., Strisovsky K., Clemmer KM., Bhatt S., Freeman M., Rather PN. Only protein-protein interactions imex curation a1yh68_prost Sec-independent protein translocase protein TatA tatA NCTC12257_03922 protein protein prost Providencia stuartii MESTIATAAFGSPWQLIIIALLIILIFGTKKLRSLGSDLGESLKGFKKAMNDDEAAKAAKEEQEKQDADFAPKNITEQQQAADKKDSPVESKNKEQG aara_prost Rhomboid protease AarA aarA Intramembrane serine protease protein protein prost Providencia stuartii MAEQQNPFSIKSKARFSLGAIALTLTLVLLNIAVYFYQIVFASPLDSRESNLILFGANIYQLSLTGDWWRYPISMMLHSNGTHLAFNCLALFVIGIGCERAYGKFKLLAIYIISGIGAALFSAYWQYYEISNSDLWTDSTVYITIGVGASGAIMGIAAASVIYLIKVVINKPNPHPVIQRRQKYQLYNLIAMIALTLINGLQSGVDNAAHIGGAIIGALISIAYILVPHKLRVANLCITVIAASLLTMMIYLYSFSTNKHLLEEREFIYQEVYTELADANQ grk_drome Protein gurken CG17610 grk protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MMQIPFTRIFKVIFVLSTIVAVTDCCSSRILLLREHTLKIVQHQHSHMHEHAHELQQQIQETAVELLNRLELQRKQLEASAQEEADQLHPDTDPNPDSGGQLPNADDSIAADPEQDGIILGSSTDTWLASESSTPITDSETVTTPETVTHTGEPPPDPSSSSTPDSTTPSPNDKETEIQMLPCSEAYNTSFCLNGGHCFQHPMVNNTVFHSCLCVNDYDGERCAYKSWNGDYIYSPPTAQRKVRMAHIVFSFPVLLMLSSLYVLFAAVFMLRNVPDYRRKQQQLHLHKQRFFVRC glpg_ecoli Rhomboid protease GlpG Intramembrane serine protease JW5687 b3424 glpG protein protein ecoli Escherichia coli (strain K12) MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDVWLADESQAERVRAELARFLENPADPRYLAASWQAGHTGSGLHYRRYPFFAALRERAGPVTWVMMIACVVVFIAMQILGDQEVMLWLAWPFDPTLKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITLISALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAGWFDLFGMSMANGAHIAGLAVGLAMAFVDSLNARKRK aara-tata-4 3151985 N/A 3151988 enzyme target enzyme target substrate substrate unspecified role unspecified role 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 3151989 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli protein cleavage protein cleavage false false false aara-grk-1 3151986 N/A 3151990 enzyme target enzyme target substrate substrate unspecified role unspecified role 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 3151989 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli protein cleavage protein cleavage false false false glpg-grk-1 3151987 N/A 3151991 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli N/A 3151990 enzyme target enzyme target substrate substrate unspecified role unspecified role 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro protein cleavage protein cleavage false false false