DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ bitto-2007-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Bitto E., Bingman CA., Wesenberg GE., McCoy JG., Phillips GN. DIP original experiment: DIP-260547X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structure of aspartoacylase, the brain enzyme impaired in Canavan disease. Bitto E., Bingman CA., Wesenberg GE., McCoy JG., Phillips GN. Only protein-protein interactions imex curation bitto-2007-2 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Bitto E., Bingman CA., Wesenberg GE., McCoy JG., Phillips GN. DIP original experiment: DIP-260548X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structure of aspartoacylase, the brain enzyme impaired in Canavan disease. Bitto E., Bingman CA., Wesenberg GE., McCoy JG., Phillips GN. Only protein-protein interactions imex curation bitto-2007-3 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Bitto E., Bingman CA., Wesenberg GE., McCoy JG., Phillips GN. DIP original experiment: DIP-260549X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Structure of aspartoacylase, the brain enzyme impaired in Canavan disease. Bitto E., Bingman CA., Wesenberg GE., McCoy JG., Phillips GN. Only protein-protein interactions imex curation acy2_human Aspartoacylase Aminoacylase-2 ASPA ACY2 ASP protein protein human Homo sapiens Human MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRCCLH acy2_rat Aspartoacylase Aspa Aminoacylase-2 protein protein rat Rattus norvegicus (Rat) Rat MTSCVAEEPIKKIAIFGGTHGNELTGVFLVTHWLKNGAEVHRAGLEVKPFITNPRAVEKCTRYIDCDLNRVFDLENLSKEMSEDLPYEVRRAQEINHLFGPKNSDDAYDVVFDLHNTTSNMGCTLILEDSRNDFLIQMFHYIKTCMAPLPCSVYLIEHPSLKYATTRSIAKYPVGIEVGPQPHGVLRADILDQMRRMLKHALDFIQRFNEGKEFPPCAIDVYKIMEKVDYPRNESGDVAAVIHPNLQDQDWKPLHPGDPVFVSLDGKVIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRSTLH aspa-1 3151784 N/A 3151787 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false aspa-2 3151785 N/A 3151788 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false aspa-3 3151786 N/A 3151788 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false