DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ zhao-2007-2 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhao R., Oxley D., Smith TS., Follows GA., Green AR., Alexander DR. DIP original experiment: DIP-66494X PLoS biology 2007 IMEx DNA damage-induced Bcl-xL deamidation is mediated by NHE-1 antiport regulated intracellular pH. Zhao R., Oxley D., Smith TS., Follows GA., Green AR., Alexander DR. Only protein-protein interactions imex curation zhao-2007-3 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhao R., Oxley D., Smith TS., Follows GA., Green AR., Alexander DR. DIP original experiment: DIP-66495X PLoS biology 2007 IMEx DNA damage-induced Bcl-xL deamidation is mediated by NHE-1 antiport regulated intracellular pH. Zhao R., Oxley D., Smith TS., Follows GA., Green AR., Alexander DR. Only protein-protein interactions imex curation zhao-2007-4 in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom predetermined predetermined participant predetermined Zhao R., Oxley D., Smith TS., Follows GA., Green AR., Alexander DR. DIP original experiment: DIP-66496X PLoS biology 2007 IMEx DNA damage-induced Bcl-xL deamidation is mediated by NHE-1 antiport regulated intracellular pH. Zhao R., Oxley D., Smith TS., Follows GA., Green AR., Alexander DR. Only protein-protein interactions imex curation zhao-2007-5 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhao R., Oxley D., Smith TS., Follows GA., Green AR., Alexander DR. DIP original experiment: DIP-66497X PLoS biology 2007 IMEx DNA damage-induced Bcl-xL deamidation is mediated by NHE-1 antiport regulated intracellular pH. Zhao R., Oxley D., Smith TS., Follows GA., Green AR., Alexander DR. Only protein-protein interactions imex curation o54918-3 Bcl-2-like protein 11 Bcl2l11 Bim Bcl2-interacting mediator of cell death protein protein mouse Mus musculus Mouse MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRVFANDYREAEDHPQMVILQLLRFIFRLVWRRH q07817-1 Bcl-2-like protein 1 BCLX Apoptosis regulator Bcl-X BCL2L1 BCL2L Bcl-xL protein protein human Homo sapiens Human MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK bbc3_human Bcl-2-binding component 3, isoforms 1/2 p53 up-regulated modulator of apoptosis JFY-1 BBC3 PUMA protein protein human Homo sapiens Human MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAAPTLLPAAYLCAPTAPPAVTAALGGSRWPGGPRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN bcl2l11-bcl2l1-2 3151516 N/A 3151520 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3151521 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association false false false bcl2l1-bbc3-1 3151517 N/A 3151522 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3151520 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3151521 unspecified role unspecified role bait bait mouse Mus musculus Mouse association association false false false bcl2l1-bcl2l11-5 3151518 N/A 3151520 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3151521 unspecified role unspecified role bait bait ecolx Escherichia coli direct interaction direct interaction false false false bbc3-bcl2l1-1 3151519 N/A 3151522 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3151521 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association false false false