DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ ghil-2006-1 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Ghil S., Choi JM., Kim SS., Lee YD., Liao Y., Birnbaumer L., Suh-Kim H. DIP original experiment: DIP-264256X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Compartmentalization of protein kinase A signaling by the heterotrimeric G protein Go. Ghil S., Choi JM., Kim SS., Lee YD., Liao Y., Birnbaumer L., Suh-Kim H. Only protein-protein interactions imex curation ghil-2006-2 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Ghil S., Choi JM., Kim SS., Lee YD., Liao Y., Birnbaumer L., Suh-Kim H. DIP original experiment: DIP-264260X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Compartmentalization of protein kinase A signaling by the heterotrimeric G protein Go. Ghil S., Choi JM., Kim SS., Lee YD., Liao Y., Birnbaumer L., Suh-Kim H. Only protein-protein interactions imex curation ghil-2006-3 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ghil S., Choi JM., Kim SS., Lee YD., Liao Y., Birnbaumer L., Suh-Kim H. DIP original experiment: DIP-264258X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Compartmentalization of protein kinase A signaling by the heterotrimeric G protein Go. Ghil S., Choi JM., Kim SS., Lee YD., Liao Y., Birnbaumer L., Suh-Kim H. Only protein-protein interactions imex curation ghil-2006-4 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Ghil S., Choi JM., Kim SS., Lee YD., Liao Y., Birnbaumer L., Suh-Kim H. DIP original experiment: DIP-264261X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Compartmentalization of protein kinase A signaling by the heterotrimeric G protein Go. Ghil S., Choi JM., Kim SS., Lee YD., Liao Y., Birnbaumer L., Suh-Kim H. Only protein-protein interactions imex curation ghil-2006-5 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Ghil S., Choi JM., Kim SS., Lee YD., Liao Y., Birnbaumer L., Suh-Kim H. DIP original experiment: DIP-264259X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Compartmentalization of protein kinase A signaling by the heterotrimeric G protein Go. Ghil S., Choi JM., Kim SS., Lee YD., Liao Y., Birnbaumer L., Suh-Kim H. Only protein-protein interactions imex curation ghil-2006-6 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Ghil S., Choi JM., Kim SS., Lee YD., Liao Y., Birnbaumer L., Suh-Kim H. DIP original experiment: DIP-264257X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Compartmentalization of protein kinase A signaling by the heterotrimeric G protein Go. Ghil S., Choi JM., Kim SS., Lee YD., Liao Y., Birnbaumer L., Suh-Kim H. Only protein-protein interactions imex curation gnao_rat Guanine nucleotide-binding protein G(o) subunit alpha Gnao1 Gna0 Gnao protein protein rat Rattus norvegicus (Rat) Rat MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDGFSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGVEYGDKERKADSKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFGEKIKKSPLTICFPEYPGSNTYEDAAAYIQTQFESKNRSPNKEIYCHMTCATDTNNIQVVFDAVTDIIIANNLRGCGLY mint Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. The G(o) protein function is not clear homomint kapca_rat cAMP-dependent protein kinase catalytic subunit alpha Prkaca protein protein rat Rattus norvegicus (Rat) Rat MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWEDPSQNTAQLDHFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFTEF kap3_rat cAMP-dependent protein kinase type II-beta regulatory subunit Prkar2b protein protein rat Rattus norvegicus (Rat) Rat MSIEIPAGLTELLQGFTVEVLRHQPADLLEFALQHFTRLQQENERKGAARFGHEGRTWGDAGAAAGGGTPSKGVNFAEEPMRSDSENGEEEEAAEAGAFNAPVINRFTRRASVCAEAYNPDEEEDDAESRIIHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKEGEHVIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATSPGALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEVSERLKVVDVIGTKVYNDGEQIIAQGDSADSFFIVESGEVRITMKRKGKSDIEENGAVEIARCLRGQYFGELALVTNKPRAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGTNMDIVEPTA kapca_human cAMP-dependent protein kinase catalytic subunit alpha PRKACA PKACA protein protein human Homo sapiens Human MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF kap3_human cAMP-dependent protein kinase type II-beta regulatory subunit PRKAR2B protein protein human Homo sapiens Human MSIEIPAGLTELLQGFTVEVLRHQPADLLEFALQHFTRLQQENERKGTARFGHEGRTWGDLGAAAGGGTPSKGVNFAEEPMQSDSEDGEEEEAAPADAGAFNAPVINRFTRRASVCAEAYNPDEEEDDAESRIIHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKDGEHVIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATSPGALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEFSERLKVVDVIGTKVYNDGEQIIAQGDSADSFFIVESGEVKITMKRKGKSEVEENGAVEIARCSRGQYFGELALVTNKPRAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGTNMDIVEPTA gnao1-prkaca-1 3150991 N/A 3150997 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3150998 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat N/A 3150999 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat association association false false false prkaca-prkar2b-6 3150992 N/A 3151000 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3151001 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false prkaca-gnao1-1 3150993 N/A 3151000 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3150997 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false gnao1-prkaca-2 3150994 N/A 3151000 unspecified role unspecified role prey prey ecolx Escherichia coli N/A 3150997 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false prkaca-gnao1-2 3150995 N/A 3151000 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3150997 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false gnao1-prkaca-3 3150996 N/A 3151000 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3150997 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3151001 unspecified role unspecified role prey prey human Homo sapiens Human association association false false false