DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ reverter-2006-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Reverter D., Lima CD. DIP original experiment: DIP-66593X Nature structural & molecular biology 2006 IMEx Structural basis for SENP2 protease interactions with SUMO precursors and conjugated substrates. Reverter D., Lima CD. Only protein-protein interactions imex curation reverter-2006-2 in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Reverter D., Lima CD. DIP original experiment: DIP-66594X Nature structural & molecular biology 2006 IMEx Structural basis for SENP2 protease interactions with SUMO precursors and conjugated substrates. Reverter D., Lima CD. Only protein-protein interactions imex curation reverter-2006-3 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Reverter D., Lima CD. DIP original experiment: DIP-66595X Nature structural & molecular biology 2006 IMEx Structural basis for SENP2 protease interactions with SUMO precursors and conjugated substrates. Reverter D., Lima CD. Only protein-protein interactions imex curation reverter-2006-4 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Reverter D., Lima CD. DIP original experiment: DIP-66596X Nature structural & molecular biology 2006 IMEx Structural basis for SENP2 protease interactions with SUMO precursors and conjugated substrates. Reverter D., Lima CD. Only protein-protein interactions imex curation reverter-2006-5 in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Reverter D., Lima CD. DIP original experiment: DIP-66597X Nature structural & molecular biology 2006 IMEx Structural basis for SENP2 protease interactions with SUMO precursors and conjugated substrates. Reverter D., Lima CD. Only protein-protein interactions imex curation reverter-2006-6 in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Reverter D., Lima CD. DIP original experiment: DIP-66598X Nature structural & molecular biology 2006 IMEx Structural basis for SENP2 protease interactions with SUMO precursors and conjugated substrates. Reverter D., Lima CD. Only protein-protein interactions imex curation reverter-2006-7 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Reverter D., Lima CD. DIP original experiment: DIP-66599X Nature structural & molecular biology 2006 IMEx Structural basis for SENP2 protease interactions with SUMO precursors and conjugated substrates. Reverter D., Lima CD. Only protein-protein interactions imex curation reverter-2006-8 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Reverter D., Lima CD. DIP original experiment: DIP-66600X Nature structural & molecular biology 2006 IMEx Structural basis for SENP2 protease interactions with SUMO precursors and conjugated substrates. Reverter D., Lima CD. Only protein-protein interactions imex curation reverter-2006-9 in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Reverter D., Lima CD. DIP original experiment: DIP-66601X Nature structural & molecular biology 2006 IMEx Structural basis for SENP2 protease interactions with SUMO precursors and conjugated substrates. Reverter D., Lima CD. Only protein-protein interactions imex curation reverter-2006-10 in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Reverter D., Lima CD. DIP original experiment: DIP-66602X Nature structural & molecular biology 2006 IMEx Structural basis for SENP2 protease interactions with SUMO precursors and conjugated substrates. Reverter D., Lima CD. Only protein-protein interactions imex curation reverter-2006-11 in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Reverter D., Lima CD. DIP original experiment: DIP-66603X Nature structural & molecular biology 2006 IMEx Structural basis for SENP2 protease interactions with SUMO precursors and conjugated substrates. Reverter D., Lima CD. Only protein-protein interactions imex curation ragp1_human Ran GTPase-activating protein 1 RANGAP1 KIAA1835 SD protein protein human Homo sapiens Human MASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDSLEALRLEGNTVGVEAARVIAKALEKKSELKRCHWSDMFTGRLRTEIPPALISLGEGLITAGAQLVELDLSDNAFGPDGVQGFEALLKSSACFTLQELKLNNCGMGIGGGKILAAALTECHRKSSAQGKPLALKVFVAGRNRLENDGATALAEAFRVIGTLEEVHMPQNGINHPGITALAQAFAVNPLLRVINLNDNTFTEKGAVAMAETLKTLRQVEVINFGDCLVRSKGAVAIADAIRGGLPKLKELNLSFCEIKRDAALAVAEAMADKAELEKLDLNGNTLGEEGCEQLQEVLEGFNMAKVLASLSDDEDEEEEEEGEEEEEEAEEEEEEDEEEEEEEEEEEEEEPQQRGQGEKSATPSRKILDPNTGEPAPVLSSPPPADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV sumo1_human Small ubiquitin-related modifier 1 SUMO1 Sentrin Ubiquitin-like protein SMT3C Ubiquitin-homology domain protein PIC1 Ubiquitin-like protein UBL1 GAP-modifying protein 1 SMT3 homolog 3 SMT3C SMT3H3 UBL1 OK/SW-cl.43 protein protein human Homo sapiens Human MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV senp2_human Sentrin-specific protease 2 Sentrin/SUMO-specific protease SENP2 SMT3-specific isopeptidase 2 Axam2 SENP2 KIAA1331 protein protein human Homo sapiens Human MYRWLVRILGTIFRFCDRSVPPARALLKRRRSDSTLFSTVDTDEIPAKRPRLDCFIHQVKNSLYNAASLFGFPFQLTTKPMVTSACNGTRNVAPSGEVFSNSSSCELTGSGSWNNMLKLGNKSPNGISDYPKIRVTVTRDQPRRVLPSFGFTLNSEGCNRRPGGRRHSKGNPESSLMWKPQEQAVTEMISEESGKGLRRPHCTVEEGVQKEEREKYRKLLERLKESGHGNSVCPVTSNYHSSQRSQMDTLKTKGWGEEQNHGVKTTQFVPKQYRLVETRGPLCSLRSEKRCSKGKITDTETMVGIRFENESRRGYQLEPDLSEEVSARLRLGSGSNGLLRRKVSIIETKEKNCSGKERDRRTDDLLELTEDMEKEISNALGHGPQDEILSSAFKLRITRGDIQTLKNYHWLNDEVINFYMNLLVERNKKQGYPALHVFSTFFYPKLKSGGYQAVKRWTKGVNLFEQEIILVPIHRKVHWSLVVIDLRKKCLKYLDSMGQKGHRICEILLQYLQDESKTKRNSDLNLLEWTHHSMKPHEIPQQLNGSDCGMFTCKYADYISRDKPITFTQHQMPLFRKKMVWEILHQQLL sumo2_human Small ubiquitin-related modifier 2 SMT3 homolog 2 Sentrin-2 HSMT3 SUMO-3 SUMO2 SMT3H2 SMT3B Ubiquitin-like protein SMT3B protein protein human Homo sapiens Human MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY sumo3_human Small ubiquitin-related modifier 3 SMT3 homolog 1 SUMO-2 SMT3H1 SUMO3 SMT3A Ubiquitin-like protein SMT3A protein protein human Homo sapiens Human MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF rangap1-senp2-1 3150506 N/A 3150517 unspecified role unspecified role neutral component neutral component 419-587 bindng region 419-587 bindng region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3150518 unspecified role unspecified role neutral component neutral component 18-97 binding region 18-97 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3150519 unspecified role unspecified role neutral component neutral component 364-589 binding region 364-589 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false Q9HC62:p.Cys548Ser C548S mutation mutation mutation predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false rangap1-senp2-2 3150507 N/A 3150520 unspecified role unspecified role neutral component neutral component 14-93 binding region 14-93 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3150517 unspecified role unspecified role neutral component neutral component 419-587 bindng region 419-587 bindng region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3150519 unspecified role unspecified role neutral component neutral component 364-589 binding region 364-589 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false Q9HC62:p.Cys548Ser C548S mutation mutation mutation predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false rangap1-senp2-3 3150508 N/A 3150517 unspecified role unspecified role neutral component neutral component 419-587 bindng region 419-587 bindng region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3150518 unspecified role unspecified role neutral component neutral component 18-101 binding region 18-101 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3150519 unspecified role unspecified role neutral component neutral component 364-589 binding region 364-589 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false Q9HC62:p.Cys548Ser C548S mutation mutation mutation predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false rangap1-senp2-4 3150509 N/A 3150520 unspecified role unspecified role neutral component neutral component 14-95 binding region 14-95 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3150517 unspecified role unspecified role neutral component neutral component 419-587 bindng region 419-587 bindng region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3150519 unspecified role unspecified role neutral component neutral component 364-589 binding region 364-589 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false Q9HC62:p.Cys548Ser C548S mutation mutation mutation predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false rangap1-senp2-5 3150510 N/A 3150517 enzyme target enzyme target substrate substrate neutral component neutral component 419-587 bindng region 419-587 bindng region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3150518 enzyme target enzyme target substrate substrate neutral component neutral component 18-101 binding region 18-101 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3150519 enzyme enzyme neutral component neutral component 364-589 binding region 364-589 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false rangap1-senp2-6 3150511 N/A 3150520 enzyme target enzyme target substrate substrate neutral component neutral component 14-95 binding region 14-95 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3150517 enzyme target enzyme target substrate substrate neutral component neutral component 419-587 bindng region 419-587 bindng region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3150519 enzyme enzyme neutral component neutral component 364-589 binding region 364-589 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false senp2-sumo2-3 3150512 N/A 3150520 unspecified role unspecified role neutral component neutral component 14-95 binding region 14-95 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3150519 unspecified role unspecified role neutral component neutral component 364-589 binding region 364-589 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false Q9HC62:p.Cys548Ser C548S mutation mutation mutation predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false senp2-sumo3-6 3150513 N/A 3150521 unspecified role unspecified role neutral component neutral component 14-103 binding region 14-103 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3150519 unspecified role unspecified role neutral component neutral component 364-589 binding region 364-589 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false Q9HC62:p.Cys548Ser C548S mutation mutation mutation predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false senp2-sumo2-4 3150514 N/A 3150520 enzyme target enzyme target substrate substrate neutral component neutral component 14-95 binding region 14-95 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3150519 enzyme enzyme neutral component neutral component 364-589 binding region 364-589 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false senp2-sumo3-7 3150515 N/A 3150521 enzyme target enzyme target substrate substrate neutral component neutral component 14-103 binding region 14-103 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3150519 enzyme enzyme neutral component neutral component 364-589 binding region 364-589 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false senp2-sumo1-2 3150516 N/A 3150518 enzyme target enzyme target substrate substrate unspecified role unspecified role 18-101 binding region 18-101 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false N/A 3150519 enzyme enzyme neutral component neutral component 364-589 binding region 364-589 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false