DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ worley-2006-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Worley MJ., Nieman GS., Geddes K., Heffron F. DIP original experiment: DIP-264185X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Salmonella typhimurium disseminates within its host by manipulating the motility of infected cells. Worley MJ., Nieman GS., Geddes K., Heffron F. Only protein-protein interactions imex curation worley-2006-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Worley MJ., Nieman GS., Geddes K., Heffron F. DIP original experiment: DIP-264186X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Salmonella typhimurium disseminates within its host by manipulating the motility of infected cells. Worley MJ., Nieman GS., Geddes K., Heffron F. Only protein-protein interactions imex curation q15654-1 Thyroid receptor-interacting protein 6 TRIP6 OIP1 Opa-interacting protein 1 Zyxin-related protein 1 protein protein human Homo sapiens Human MSGPTWLPPKQPEPARAPQGRAIPRGTPGPPPAHGAALQPHPRVNFCPLPSEQCYQAPGGPEDRGPAWVGSHGVLQHTQGLPADRGGLRPGSLDAEIDLLSSTLAELNGGRGHASRRPDRQAYEPPPPPAYRTGSLKPNPASPLPASPYGGPTPASYTTASTPAGPAFPVQVKVAQPVRGCGPPRRGASQASGPLPGPHFPLPGRGEVWGPGYRSQREPGPGAKEEAAGVSGPAGRGRGGEHGPQVPLSQPPEDELDRLTKKLVHDMNHPPSGEYFGQCGGCGEDVVGDGAGVVALDRVFHVGCFVCSTCRAQLRGQHFYAVERRAYCEGCYVATLEKCATCSQPILDRILRAMGKAYHPGCFTCVVCHRGLDGIPFTVDATSQIHCIEDFHRKFAPRCSVCGGAIMPEPGQEETVRIVALDRSFHIGCYKCEECGLLLSSEGECQGCYPLDGHILCKACSAWRIQELSATVTTDC ssei_salty Secreted effector protein SseI sseI srfH STM1051 protein protein salty Salmonella typhimurium MPFHIGSGCLPAIISNRRIYRIAWSDTPPEMSSWEKMKEFFCSTHQAEALECIWTICHPPAGTTREDVVSRFELLRTLAYDGWEENIHSGLHGENYFCILDEDSQEILSVTLDDVGNYTVNCQGYSETHHLTMATEPGVERTDITYNLTSDIDAAAYLEELKQNPIINNKIMNPVGQCESLMTPVSNFMNEKGFDNIRYRGIFIWDKPTEEIPTNHFAVVGNKEGKDYVFDVSAHQFENRGMSNLNGPLILSADEWVCKYRMATRRKLIYYTDFSNSSIAANAYDALPRELESESMAGKVFVTSPRWFNTFKKQKYSLIGKM ssei-trip6-1 3150300 N/A 3150302 unspecified role unspecified role prey prey Region 327-476 Region 327-476 sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3150303 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false ssei-trip6-2 3150301 N/A 3150302 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3150303 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false