DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ harrison-2006-1 caeel Caenorhabditis elegans molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Harrison MM., Ceol CJ., Lu X., Horvitz HR. DIP original experiment: DIP-264078X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Some C. elegans class B synthetic multivulva proteins encode a conserved LIN-35 Rb-containing complex distinct from a NuRD-like complex. Harrison MM., Ceol CJ., Lu X., Horvitz HR. Only protein-protein interactions imex curation harrison-2006-2 caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Harrison MM., Ceol CJ., Lu X., Horvitz HR. DIP original experiment: DIP-264087X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Some C. elegans class B synthetic multivulva proteins encode a conserved LIN-35 Rb-containing complex distinct from a NuRD-like complex. Harrison MM., Ceol CJ., Lu X., Horvitz HR. Only protein-protein interactions imex curation harrison-2006-3 caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Harrison MM., Ceol CJ., Lu X., Horvitz HR. DIP original experiment: DIP-264084X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Some C. elegans class B synthetic multivulva proteins encode a conserved LIN-35 Rb-containing complex distinct from a NuRD-like complex. Harrison MM., Ceol CJ., Lu X., Horvitz HR. Only protein-protein interactions imex curation harrison-2006-4 caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Harrison MM., Ceol CJ., Lu X., Horvitz HR. DIP original experiment: DIP-264081X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Some C. elegans class B synthetic multivulva proteins encode a conserved LIN-35 Rb-containing complex distinct from a NuRD-like complex. Harrison MM., Ceol CJ., Lu X., Horvitz HR. Only protein-protein interactions imex curation harrison-2006-5 caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Harrison MM., Ceol CJ., Lu X., Horvitz HR. DIP original experiment: DIP-264082X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Some C. elegans class B synthetic multivulva proteins encode a conserved LIN-35 Rb-containing complex distinct from a NuRD-like complex. Harrison MM., Ceol CJ., Lu X., Horvitz HR. Only protein-protein interactions imex curation harrison-2006-6 caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Harrison MM., Ceol CJ., Lu X., Horvitz HR. DIP original experiment: DIP-264079X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Some C. elegans class B synthetic multivulva proteins encode a conserved LIN-35 Rb-containing complex distinct from a NuRD-like complex. Harrison MM., Ceol CJ., Lu X., Horvitz HR. Only protein-protein interactions imex curation harrison-2006-7 caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Harrison MM., Ceol CJ., Lu X., Horvitz HR. DIP original experiment: DIP-264083X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Some C. elegans class B synthetic multivulva proteins encode a conserved LIN-35 Rb-containing complex distinct from a NuRD-like complex. Harrison MM., Ceol CJ., Lu X., Horvitz HR. Only protein-protein interactions imex curation harrison-2006-8 caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Harrison MM., Ceol CJ., Lu X., Horvitz HR. DIP original experiment: DIP-264080X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Some C. elegans class B synthetic multivulva proteins encode a conserved LIN-35 Rb-containing complex distinct from a NuRD-like complex. Harrison MM., Ceol CJ., Lu X., Horvitz HR. Only protein-protein interactions imex curation harrison-2006-9 caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Harrison MM., Ceol CJ., Lu X., Horvitz HR. DIP original experiment: DIP-264085X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Some C. elegans class B synthetic multivulva proteins encode a conserved LIN-35 Rb-containing complex distinct from a NuRD-like complex. Harrison MM., Ceol CJ., Lu X., Horvitz HR. Only protein-protein interactions imex curation harrison-2006-10 caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Harrison MM., Ceol CJ., Lu X., Horvitz HR. DIP original experiment: DIP-264086X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Some C. elegans class B synthetic multivulva proteins encode a conserved LIN-35 Rb-containing complex distinct from a NuRD-like complex. Harrison MM., Ceol CJ., Lu X., Horvitz HR. Only protein-protein interactions imex curation lin54_caeel Protein lin-54 lin-54 Abnormal cell lineage protein 54 JC8.6 protein protein caeel Caenorhabditis elegans MNQGEIVYQDDDDYYDESEIYDNYEEGAEFIEVNGQLVPHNPNLQAQQNRPGTSSMIQQHNRSMEVNQGLVKDEPIDTSSHRVYVPPPRPVQRKLFQPGPSTPGSSQYTVRNLSNLSGSPSMYDRQPASLPRTVQPMGLEMGNSEQRKVYIDMKDHVSHIRLKTKKKVFAPGQRKPCNCTKSQCLKLYCDCFANGEFCRDCNCKDCHNNIEYDSQRSKAIRQSLERNPNAFKPKIGIARGGITDIERLHQKGCHCKKSGCLKNYCECYEAKVPCTDRCKCKGCQNTETYRMTRYKNSGGAVSNTNALMSLTNASSTATPDSGPGSVVTDEHGDDYEDMLLSHKPKVEMDPRRFPWYYMTDEVVEAATMCMVAQAEEALNYEKVQTEDEKLINMEKLVLREFGRCLEQMITNTTELTQDLDAAPTDDIPGPSTSTS q23482_caeel lin-37 ZK418.4 CELE_ZK418.4 protein protein caeel Caenorhabditis elegans MSEIDPLAEFLLPEDGDRNARQNDPLISGGPLPLESPSRKLTSLLSYDPTVPESPDMKFARKRLGNLLTTIKHHPSEIIGVLPEDYTRADEEPGRQGRPPGRPRKMPRHESSTSLMESPRKTMTRDSKIMFELRGKPFEMIAGRFEEEYSLGRAWVKGHMNNEYEPIKAQRTDYAPNLAVDYLACREIHRMPRPDKSIPELPIVPSRIDEFDATVDPRYETDLKNEYIRHWKQVKKGWCAHQRRRTAPHARSIALINKIYQPGESKTVEQALGLI lin35_caeel Retinoblastoma-like protein homolog lin-35 lin-35 Abnormal cell lineage protein 35 Synthetic multivulva protein lin-35 C32F10.2 protein protein caeel Caenorhabditis elegans MPKRAADEPGTSTTDPFHEQSPFDAVLAGTETTDTICEEPPAKRIDLDIKQEFNGGVQSGGLIKNESELTQMTIKQETEGNINEARREEEDEEQDEDSRTSMPPALGEDDDYEEDDADSFIDKTNTPPPSQSFLEGCRAANLPNDIVTGAWETYNHAVQRVSLEGSESAWQLSAIYYYLLSKGIKRRGKTIRILIQPFPVSILTIANSFDISVAEMLDKTARFVEIIHSRKIRRYQEYIRRIQEGLAVSCVIFKKFCRIFCKIFEEIKVGSENCPSSHELFTVLWTSFLVMKSRMTVDDLISNYQLLFSILDQVYTEMCSMKEGIVHHLNQKFVEDLLENDCTIIRALCTQFGGSVLDARHFSDHTFKKMEKTGIPSTWNFQEFRDLIMNVPKTAYENYLLQRGSIDERIFIPSVEDFSKIFQSPDTYSVADILKVSYSGRRFRDAEFLTKISNNHCLEKLALGGKVASEKLVTQSKEQPRVPCVEYNLELGNYPDDLESNNQSLYNRLTKIIGSWKLENSKLEEVCGTMSDSPMATILLKSDEMTNKFERTLSAELGETINENIPKYHYNVRKELELVFLIFMEKIIVAELKKKVREEDLLNVIRREEFLDSVFCFCVELILVSNGYDRPFPWSAELCGVHPFMFHKVIDLMITHEKQLSRQMVQHFSRIEETVIEYFSWKSDSPLWPMVVRCPFAHFQEFGEDWADKLNSYSPIKFTPIKKPDDLRDELGRPIVPQNQTSRTLRIFLKRTYFTAARRLQDLTDRVSMGARAKSQCWSLFDYLLRNDTLIFMDRHLDQILLCCVFVIMKINESSMLFTEIMAQYRRQSANSLLVYRSVTVFQEQLNPENPQAVNTKETILERLEGPQKEKTTVDIIKYYNIEFRDRIKYIIGQIDSASDEDLMEMPVATESGLMPVRVYLTHKLSIQTLPKTKHGESKQERAIANLEKSGITIAMERSGD lin52_caeel Protein lin-52 lin-52 Abnormal cell lineage protein 52 ZK632.13 protein protein caeel Caenorhabditis elegans MSRPLGFIGYEFGDDEMFVQQMIEKKSNAEQAKMLEQQKKMLECTETMPEESEPVPMKCLDFEEAFQSESVSKGYESPYKNISFLKEDAVTVNTMSHCPADDIAKLIRNIQNSVYTLGIEEARQCRRGKLLNVLKPTGSASPRYLQPTPPKNVAEETTGSQ lin9_caeel Protein lin-9 lin-9 Abnormal cell lineage protein 9 ZK637.7 protein protein caeel Caenorhabditis elegans MSSAVRSPRKKAASDTSDPDRTSSPYSLRETSKVPSRYRNEELYLSPSRSIKRTGSPKKSPAKRLNGGRDSPSVNSLTRNSSLTMLAKAALDYESSSCALEYIFQPKEERRPPRRALALSPPPAPSNDLLAKDLEMIEMHQNLVAGLDDLDNPANMTNEAVEHRDTQSFFNMFSTDQERSAMMKQFKTYKNQTSEDVSTFMRANIKKLYNLLRYKKARQWVMCEFFYSAIDEQIFKEENEFATIIRESFPNLKNWNLTRIEWRSIRKLLGKPRRCSKVFFEEERMYLEEKRMKIRSVYEGSYLNDPSIDLKDLPAKLPRPMVVGNRVFARIRNPYDGIYSGIIDAVIPKGFRIIFDKPDIPPTLVSDTEILLDGKLDLLSIAYFIEQANSKLPSGVRPFVAAVRDSSHPHLVRDVLVSRKIERSGGPLMGPNDERLNGKNAEMVGNFPLKFLVNLVKLTKLIDIKKGLIRQLNELNADAEIQNMTSDKYSKAFQEKYAKTIIDLEHVNQNIDINMNGIQDHHMYFSSNDISTSNMKPEAVRQMCSQQAGRFVEHCNQGLNVENVHALTLIQSLTAVLLQVRTMGTQKISAVDLQSLGDAISEIRTAIHPRNVAFFQDYVEVHMKQFHTIMLESGALAGTVSNRK lin53_caeel Probable histone-binding protein lin-53 lin-53 rba-2 K07A1.12 Abnormal cell lineage protein 53 Synthetic multivulva protein p48 protein protein caeel Caenorhabditis elegans MATLEDGTSEDRVANDEYKIWKKNTPFLYDLVMTHALEWPSLSVQWLPDVAKDNSDHTIHRLILGTHTSDEQNHLLISKICMPTDDAQFDASRYDTERSEYGGFGAVNGKVEPDIRINHEGEVNRARYMPQKSNIIATKSPHADVYIFDYLKHSAVPRDNTFNPLIRLKGHTKEGYGLSWNPNKEGLILSASDDQTVCHWDINANQNVAGELQAKDVFKGHESVVEDVAWHVLHDGVFGSVGDDKKLLIWDVRTSTPGHCIDAHSAEVNCLAFNPYSEFILATGSADKTVALWDLRNLRMKLHSFESHRDEIFQVQWSPHNETILASSGTDKRLHVWDLSKIGEDQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVVCSVSEDNILQVWQMADNIYNEVDEETPADVVERQQ lin8_caeel Protein lin-8 lin-8 Abnormal cell lineage protein 8 B0454.1 protein protein caeel Caenorhabditis elegans MSKIKTHSTGSKRTVPFYKLPPPVPLPPLPPPDPTRYFSTEKYIALSKDEKFKFDDYDVNDETLKKVVLNEIGKCPDIWSSRSQAAIMEHYPIVATETYRRTGLLLSIKSLKQIYKCGKDNLRNRLRVAIVSKRLTPAQVEAYMWRWEFYGFIRYYRDYTQRWEADLLKDLDVVLGLEARRASKNMEKVDSGELMEPMEPMDSTMDEMCVEEEPYEETGSNWSDPAPEPSQSKSQSPEAKYPQAYLLPEADEVYNPDDFYQEEHESASNAMYRIAFSQQYGGGGSPAVQKPVTFSAQPAPAPVREAPSPVVENVSSSSFTPKPPAMINNFGEEMNQITYQAIRIAREQPERLKLLRKALFDVVLAFDQKEYADVGDLYRDLAQKNS tfdp1_caeel Transcription factor dpl-1 dpl-1 T23G7.1 protein protein caeel Caenorhabditis elegans MNPTNYDPRIGQPAQSRPQVSLSMGRRIVQMPTGLPRSYQDESHNEPVGWDEPSGVGGSSGAGGQQSDKPTGLRHFSTKVCEKVKEKGLTNYNEVADELVADYFQNNLIKQIDVVKQEYDMKNIRRRVYDALNVLLAMNIITKSKKDIRWIGLPASASQEISRLEEEKSRREASISSKKQALEEMVLQIVSYKNLVERNRKNEHKNGRPENDTVLHLPFLIINTDKEANVECSVSSDKSEFLFSFDKKFEIHDDFEILKKLNLACSLETTNPTAEEVKTAKSFLPTLHQHYVDEIIANRKKVEAEKEEKRKQQQLIADQMSMNLSQAQYVEPTSSLAQMSYSSRFNRQLQEHLINDGSEDRSAAAGIMERDYDMDKNVNQGSASRGPMYNTYSPQKIRAQVNTPLQVPPVTKRYYVQKTQGPMKHDMTPVVRTVNRPYSTVPPDRRLSTGATSVNSGPVKYYVPQGHQPMHQPVGQRYRVRPQQPQMSHMGQPHQVQQRVVYPAGSISGHQLQPGQRIVTQRIVAPGGPHPPGTIVRKVIRKIVVNNPKQSPAQQVIQKKMMEQDMCTFERKTEQPMTSAQAAALIQHPQPEEYDYFQ lin_37-lin_54-1 3149828 N/A 3149838 unspecified role unspecified role unspecified role unspecified role caeel Caenorhabditis elegans N/A 3149839 unspecified role unspecified role unspecified role unspecified role caeel Caenorhabditis elegans physical association physical association false false false lin_9-lin_35-1 3149829 N/A 3149838 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3149839 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3149840 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3149841 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3149842 unspecified role unspecified role bait bait caeel Caenorhabditis elegans association association false false false lin_37-lin_52-1 3149830 N/A 3149838 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3149839 unspecified role unspecified role bait bait caeel Caenorhabditis elegans N/A 3149843 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3149841 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3149842 unspecified role unspecified role prey prey caeel Caenorhabditis elegans association association false false false lin_9-lin_35-2 3149831 N/A 3149838 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3149839 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3149840 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3149843 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3149841 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3149842 unspecified role unspecified role bait bait caeel Caenorhabditis elegans association association false false false lin_52-lin_35-1 3149832 N/A 3149838 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3149839 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3149840 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3149843 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3149841 unspecified role unspecified role bait bait caeel Caenorhabditis elegans N/A 3149842 unspecified role unspecified role prey prey caeel Caenorhabditis elegans association association false false false lin_37-dpl_1-1 3149833 N/A 3149838 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3149844 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3149839 unspecified role unspecified role bait bait caeel Caenorhabditis elegans N/A 3149840 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3149843 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3149841 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3149845 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3149842 unspecified role unspecified role prey prey caeel Caenorhabditis elegans association association false false false lin_54-lin_35-1 3149834 N/A 3149838 unspecified role unspecified role bait bait caeel Caenorhabditis elegans N/A 3149839 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3149840 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3149843 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3149841 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3149842 unspecified role unspecified role prey prey caeel Caenorhabditis elegans association association false false false lin_37-lin_35-1 3149835 N/A 3149838 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3149839 unspecified role unspecified role bait bait caeel Caenorhabditis elegans N/A 3149840 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3149843 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3149841 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3149842 unspecified role unspecified role prey prey caeel Caenorhabditis elegans association association false false false lin_52-lin_35-2 3149836 N/A 3149838 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3149840 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3149843 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3149841 unspecified role unspecified role bait bait caeel Caenorhabditis elegans N/A 3149842 unspecified role unspecified role prey prey caeel Caenorhabditis elegans association association false false false lin_37-lin_35-2 3149837 N/A 3149838 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3149839 unspecified role unspecified role bait bait caeel Caenorhabditis elegans N/A 3149840 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3149841 unspecified role unspecified role prey prey caeel Caenorhabditis elegans N/A 3149842 unspecified role unspecified role prey prey caeel Caenorhabditis elegans association association false false false