IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ garg-2006-1 human-monocyte Human mononuclear cells monocyte Monocyte, mononuclear cell anti bait coip anti bait coimmunoprecipitation anti bait coip ms participant Identification by mass spectrometry ms participant Garg A., Barnes PF., Porgador A., Roy S., Wu S., Nanda JS., Griffith DE., Girard WM., Rawal N., Shetty S., Vankayalapati R. M. tuberculosis-infected monocytes obtained from blood. (CD14+) Krishna.vankayalapati@uthct.edu Journal of immunology (Baltimore, Md. : 1950) 2006 imex curation Only protein-protein interactions garg-2006-3 in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Garg A., Barnes PF., Porgador A., Roy S., Wu S., Nanda JS., Griffith DE., Girard WM., Rawal N., Shetty S., Vankayalapati R. NKp46:Fc was determined to be of Human origin rather than Murine, as the supplier (R+D) specifically quotes this publication for the human chimera. Recombinant Vimentin has been assumed to be of Human origin: the protein cannot be traced on the supplier's web-site ( "Research Diagnostics") but all other traceable proteins are of human origin and other users cite the RD product to be of human origin. Krishna.vankayalapati@uthct.edu Journal of immunology (Baltimore, Md. : 1950) 2006 imex curation Only protein-protein interactions garg-2006-2 in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting western blot western blot Immuno blot Immuno blot Garg A., Barnes PF., Porgador A., Roy S., Wu S., Nanda JS., Griffith DE., Girard WM., Rawal N., Shetty S., Vankayalapati R. NKp46:Fc was determined to be of Human origin rather than Murine, as the supplier (R+D) specifically quotes this publication for the human chimera. Recombinant Vimentin has been assumed to be of Human origin: the protein cannot be traced on the supplier's web-site ( "Research Diagnostics") but all other traceable proteins are of human origin. Krishna.vankayalapati@uthct.edu Journal of immunology (Baltimore, Md. : 1950) 2006 imex curation Only protein-protein interactions nctr1_human Natural cytotoxicity triggering receptor 1 NCR1 LY94 Lymphocyte antigen 94 homolog NK cell-activating receptor Natural killer cell p46-related protein protein protein human Homo sapiens Human MSSTLPALLCVGLCLSQRISAQQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRRRLNTQTL vime_human Vimentin VIM protein protein human Homo sapiens Human MSTRSVSSSSYRRMFGGPGTASRPSSSRSYVTTSTRTYSLGSALRPSTSRSLYASSPGGVYATRSSAVRLRSSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKLQEEMLQREEAENTLQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHEEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESTEYRRQVQSLTCEVDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPNFSSLNLRETNLDSLPLVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE ncr1-vim-1 2969655 N/A 2969658 unspecified role unspecified role bait bait N/A 2969659 unspecified role unspecified role prey prey physical association physical association false false false none (text below figure 1) ncr1-vim-2 2969656 N/A 2969658 unspecified role unspecified role prey prey c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecd sufficient to bind sufficient binding region sufficient to bind range range range range false mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc N/A 2969659 unspecified role unspecified role bait bait direct interaction direct interaction false false false Figure 6 vim-ncr1-1 2969657 N/A 2969658 unspecified role unspecified role bait bait c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecd sufficient to bind sufficient binding region sufficient to bind range range range range false mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc N/A 2969659 unspecified role unspecified role prey prey direct interaction direct interaction false false false Figure 6B