DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ karlberg-2006-1 ecolx Escherichia coli 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Karlberg T., Schagerlöf U., Gakh O., Park S., Ryde U., Lindahl M., Leath K., Garman E., Isaya G., Al-Karadaghi S. DIP original experiment: DIP-66379X Structure (London, England : 1993) 2006 IMEx The structures of frataxin oligomers reveal the mechanism for the delivery and detoxification of iron. Karlberg T., Schagerlöf U., Gakh O., Park S., Ryde U., Lindahl M., Leath K., Garman E., Isaya G., Al-Karadaghi S. Only protein-protein interactions imex curation karlberg-2006-2 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Karlberg T., Schagerlöf U., Gakh O., Park S., Ryde U., Lindahl M., Leath K., Garman E., Isaya G., Al-Karadaghi S. DIP original experiment: DIP-66380X Structure (London, England : 1993) 2006 IMEx The structures of frataxin oligomers reveal the mechanism for the delivery and detoxification of iron. Karlberg T., Schagerlöf U., Gakh O., Park S., Ryde U., Lindahl M., Leath K., Garman E., Isaya G., Al-Karadaghi S. Only protein-protein interactions imex curation frda_yeast Frataxin homolog, mitochondrial YFH1 YDL120W protein protein yeast Saccharomyces cerevisiae Baker's yeast MIKRSLASLVRVSSVMGRRYMIAAAGGERARFCPAVTNKKNHTVNTFQKRFVESSTDGQVVPQEVLNLPLEKYHEEADDYLDHLLDSLEELSEAHPDCIPDVELSHGVMTLEIPAFGTYVINKQPPNKQIWLASPLSGPNRFDLLNGEWVSLRNGTKLTDILTEEVEKAISKSQ AB1FF7478EF0E5D6 frataxin-1 3148809 N/A 3148811 unspecified role unspecified role unspecified role unspecified role Region 52-174 Region 52-174 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q07540:p.Tyr73Ala Y73A mutation mutation certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false frataxin-2 3148810 N/A 3148811 unspecified role unspecified role unspecified role unspecified role Region 52-174 Region 52-174 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q07540:p.Tyr73Ala Y73A mutation mutation certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false