DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ zhang-2006-14 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Zhang L., Derider M., McCornack MA., Jao SC., Isern N., Ness T., Moyer R., LiWang PJ. DIP original experiment: DIP-263822X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Solution structure of the complex between poxvirus-encoded CC chemokine inhibitor vCCI and human MIP-1beta. Zhang L., Derider M., McCornack MA., Jao SC., Isern N., Ness T., Moyer R., LiWang PJ. Only protein-protein interactions imex curation ccl4_human C-C motif chemokine 4 CCL4 LAG1 MIP1B SCYA4 G-26 T-lymphocyte-secreted protein HC21 Lymphocyte activation gene 1 protein MIP-1-beta(1-69) Macrophage inflammatory protein 1-beta PAT 744 Protein H400 SIS-gamma Small-inducible cytokine A4 T-cell activation protein 2 protein protein human Homo sapiens Human MKLCVTVLSLLMLVAAFCSPALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN o10647_9poxv RPXV001 RPXV184 protein protein rabbitpox virus Rabbitpox virus MKQYIVLACMCLAAAAMPASLQQSSSSSSSCTEEENKHHMGIDVIIKVTKQDQTPTNDKICQSVTEITESESDPDPEVESEDDSTSVEDVDPPTTYYSIIGGGLRMNFGFTKCPQIKSISESADGNTVNARLSSVSPGQGKDSPAITHEEALAMIKDCEVSIDIRCSEEEKDSDIKTHPVLGSNISHKKVSYEDIIGSTIVDTKCVKNLEFSVRIGDMCKESSELEVKDGFKYVDGSASKGATDDTSLIDSTKLKACV ccl4-o10647_9poxv-1 3147760 N/A 3147761 unspecified role unspecified role unspecified role unspecified role Region 24-92 Region 24-92 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3147762 unspecified role unspecified role unspecified role unspecified role Region 17-258 Region 17-258 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false picpa Pichia pastoris (Yeast) Yeast Pichia pastoris direct interaction direct interaction false false false