DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ kim-2006-3 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. DIP original experiment: DIP-263731X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. Only protein-protein interactions imex curation kim-2006-4 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. DIP original experiment: DIP-263740X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. Only protein-protein interactions imex curation kim-2006-5 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. DIP original experiment: DIP-263736X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. Only protein-protein interactions imex curation kim-2006-6 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. DIP original experiment: DIP-263732X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. Only protein-protein interactions imex curation kim-2006-7 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. DIP original experiment: DIP-263741X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. Only protein-protein interactions imex curation kim-2006-8 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. DIP original experiment: DIP-263733X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. Only protein-protein interactions imex curation kim-2006-9 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. DIP original experiment: DIP-263737X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. Only protein-protein interactions imex curation kim-2006-10 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. DIP original experiment: DIP-263742X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. Only protein-protein interactions imex curation kim-2006-11 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. DIP original experiment: DIP-263734X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. Only protein-protein interactions imex curation kim-2006-12 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. DIP original experiment: DIP-263738X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. Only protein-protein interactions imex curation kim-2006-13 in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. DIP original experiment: DIP-263743X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. Only protein-protein interactions imex curation kim-2006-14 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. DIP original experiment: DIP-263739X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. Only protein-protein interactions imex curation kim-2006-15 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. DIP original experiment: DIP-263735X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A repressor complex, AP4 transcription factor and geminin, negatively regulates expression of target genes in nonneuronal cells. Kim MY., Jeong BC., Lee JH., Kee HJ., Kook H., Kim NS., Kim YH., Kim JK., Ahn KY., Kim KK. Only protein-protein interactions imex curation gem_human GTP-binding protein GEM GTP-binding mitogen-induced T-cell protein RAS-like protein KIR GEM KIR protein protein human Homo sapiens Human MTLNNVTMRQGTVGMQPQQQRWSIPADGRHLMVQKEPHQYSHRNRHSATPEDHCRRSWSSDSTDSVISSESGNTYYRVVLIGEQGVGKSTLANIFAGVHDSMDSDCEVLGEDTYERTLMVDGESATIILLDMWENKGENEWLHDHCMQVGDAYLIVYSITDRASFEKASELRIQLRRARQTEDIPIILVGNKSDLVRCREVSVSEGRACAVVFDCKFIETSAAVQHNVKELFEGIVRQVRLRRDSKEKNERRLAYQKRKESMPRKARRFWGKIVAKNNKNMAFKLKSKSCHDLSVL tfap4_human Transcription factor AP-4 TFAP4 Activating enhancer-binding protein 4 BHLHC41 Class C basic helix-loop-helix protein 41 protein protein human Homo sapiens Human MEYFMVPTQKVPSLQHFRKTEKEVIGGLCSLANIPLTPETQRDQERRIRREIANSNERRRMQSINAGFQSLKTLIPHTDGEKLSKAAILQQTAEYIFSLEQEKTRLLQQNTQLKRFIQELSGSSPKRRRAEDKDEGIGSPDIWEDEKAEDLRREMIELRQQLDKERSVRMMLEEQVRSLEAHMYPEKLKVIAQQVQLQQQQEQVRLLHQEKLEREQQQLRTQLLPPPAPTHHPTVIVPAPPPPPSHHINVVTMGPSSVINSVSTSRQNLDTIVQAIQHIEGTQEKQELEEEQRRAVIVKPVRSCPEAPTSDTASDSEASDSDAMDQSREEPSGDGELP q9jiz5_mouse Tfap4 Ap4 Tcfap4 protein protein mouse Mus musculus Mouse MEYFMVPTQKVPSLQHFRKTEKEVIGGLCSLANIPLTPETQRDQERRIRREIANSNERRRMQSINAGFQSLKTLIPHTDGEKLSKAAILQQTAEYIFSLEQEKTRLLQQNTQLKRFIQELSGSSPKRRRAEDKDEGIGSPDIWEDEKAEDLRREMIELRQQLDKERSVRMMLEEQVRSLEAHMYPEKLKVIAQQVQLQQQQEQVRLLHQEKLEREQQHLRTQLLPPPAPTHHPTVIVPAPAPPSSHHINVVTMGPSSVINSVSTSRQNLDTIVQAIQHIEGTQDKQELEEEQRRAVIVKSVRSCPDAHTSDTASDSEASDSDAMDQSREEPLGDGELP ncor2_human Nuclear receptor corepressor 2 NCOR2 CTG26 Silencing mediator of retinoic acid and thyroid hormone receptor Thyroid-, retinoic-acid-receptor-associated corepressor T3 receptor-associating factor CTG repeat protein 26 SMAP270 protein protein human Homo sapiens Human MSGSTQPVAQTWRATEPRYPPHSLSYPVQIARTHTDVGLLEYQHHSRDYASHLSPGSIIQPQRRRPSLLSEFQPGNERSQELHLRPESHSYLPELGKSEMEFIESKRPRLELLPDPLLRPSPLLATGQPAGSEDLTKDRSLTGKLEPVSPPSPPHTDPELELVPPRLSKEELIQNMDRVDREITMVEQQISKLKKKQQQLEEEAAKPPEPEKPVSPPPIESKHRSLVQIIYDENRKKAEAAHRILEGLGPQVELPLYNQPSDTRQYHENIKINQAMRKKLILYFKRRNHARKQWEQKFCQRYDQLMEAWEKKVERIENNPRRRAKESKVREYYEKQFPEIRKQRELQERMQSRVGQRGSGLSMSAARSEHEVSEIIDGLSEQENLEKQMRQLAVIPPMLYDADQQRIKFINMNGLMADPMKVYKDRQVMNMWSEQEKETFREKFMQHPKNFGLIASFLERKTVAECVLYYYLTKKNENYKSLVRRSYRRRGKSQQQQQQQQQQQQQQQQQPMPRSSQEEKDEKEKEKEAEKEEEKPEVENDKEDLLKEKTDDTSGEDNDEKEAVASKGRKTANSQGRRKGRITRSMANEANSEEAITPQQSAELASMELNESSRWTEEEMETAKKGLLEHGRNWSAIARMVGSKTVSQCKNFYFNYKKRQNLDEILQQHKLKMEKERNARRKKKKAPAAASEEAAFPPVVEDEEMEASGVSGNEEEMVEEAEALHASGNEVPRGECSGPATVNNSSDTESIPSPHTEAAKDTGQNGPKPPATLGADGPPPGPPTPPPEDIPAPTEPTPASEATGAPTPPPAPPSPSAPPPVVPKEEKEEETAAAPPVEEGEEQKPPAAEELAVDTGKAEEPVKSECTEEAEEGPAKGKDAEAAEATAEGALKAEKKEGGSGRATTAKSSGAPQDSDSSATCSADEVDEAEGGDKNRLLSPRPSLLTPTGDPRANASPQKPLDLKQLKQRAAAIPPIQVTKVHEPPREDAAPTKPAPPAPPPPQNLQPESDAPQQPGSSPRGKSRSPAPPADKEAFAAEAQKLPGDPPCWTSGLPFPVPPREVIKASPHAPDPSAFSYAPPGHPLPLGLHDTARPVLPRPPTISNPPPLISSAKHPSVLERQIGAISQGMSVQLHVPYSEHAKAPVGPVTMGLPLPMDPKKLAPFSGVKQEQLSPRGQAGPPESLGVPTAQEASVLRGTALGSVPGGSITKGIPSTRVPSDSAITYRGSITHGTPADVLYKGTITRIIGEDSPSRLDRGREDSLPKGHVIYEGKKGHVLSYEGGMSVTQCSKEDGRSSSGPPHETAAPKRTYDMMEGRVGRAISSASIEGLMGRAIPPERHSPHHLKEQHHIRGSITQGIPRSYVEAQEDYLRREAKLLKREGTPPPPPPSRDLTEAYKTQALGPLKLKPAHEGLVATVKEAGRSIHEIPREELRHTPELPLAPRPLKEGSITQGTPLKYDTGASTTGSKKHDVRSLIGSPGRTFPPVHPLDVMADARALERACYEESLKSRPGTASSSGGSIARGAPVIVPELGKPRQSPLTYEDHGAPFAGHLPRGSPVTTREPTPRLQEGSLSSSKASQDRKLTSTPREIAKSPHSTVPEHHPHPISPYEHLLRGVSGVDLYRSHIPLAFDPTSIPRGIPLDAAAAYYLPRHLAPNPTYPHLYPPYLIRGYPDTAALENRQTIINDYITSQQMHHNAATAMAQRADMLRGLSPRESSLALNYAAGPRGIIDLSQVPHLPVLVPPTPGTPATAMDRLAYLPTAPQPFSSRHSSSPLSPGGPTHLTKPTTTSSSERERDRDRERDRDREREKSILTSTTTVEHAPIWRPGTEQSSGSSGGGGGSSSRPASHSHAHQHSPISPRTQDALQQRPSVLHNTGMKGIITAVEPSTPTVLRSTSTSSPVRPAATFPPATHCPLGGTLDGVYPTLMEPVLLPKEAPRVARPERPRADTGHAFLAKPPARSGLEPASSPSKGSEPRPLVPPVSGHATIARTPAKNLAPHHASPDPPAPPASASDPHREKTQSKPFSIQELELRSLGYHGSSYSPEGVEPVSPVSSPSLTHDKGLPKHLEELDKSHLEGELRPKQPGPVKLGGEAAHLPHLRPLPESQPSSSPLLQTAPGVKGHQRVVTLAQHISEVITQDYTRHHPQQLSAPLPAPLYSFPGASCPVLDLRRPPSDLYLPPPDHGAPARGSPHSEGGKRSPEPNKTSVLGGGEDGIEPVSPPEGMTEPGHSRSAVYPLLYRDGEQTEPSRMGSKSPGNTSQPPAFFSKLTESNSAMVKSKKQEINKKLNTHNRNEPEYNISQPGTEIFNMPAITGTGLMTYRSQAVQEHASTNMGLEAIIRKALMGKYDQWEESPPLSANAFNPLNASASLPAAMPITAADGRSDHTLTSPGGGGKAKVSGRPSSRKAKSPAPGLASGDRPPSVSSVHSEGDCNRRTPLTNRVWEDRPSSAGSTPFPYNPLIMRLQAGVMASPPPPGLPAGSGPLAGPHHAWDEEPKPLLCSQYETLSDSE hdac3_human Histone deacetylase 3 HDAC3 RPD3-2 SMAP45 protein protein human Homo sapiens Human MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI sin3a_mouse Paired amphipathic helix protein Sin3a Sin3a Kiaa4126 Transcriptional corepressor Sin3a Histone deacetylase complex subunit Sin3a protein protein mouse Mus musculus Mouse MKRRLDDQESPVYAAQQRRIPGSTEAFSHQHRVLAPAPPVYEAVSETMQSATGIQYSVAPNYQVSAVPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVVQSHAHPAPPVAPVQGQQQFQRLKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIMGFNTFLPPGYKIEVQTNDMVNVTTPGQVHQIPTHGIQPQPQPPPQHPSQPSSQSAPTPAQPAPQPTAAKVSKPSQLQAHTPASQQTPPLPPYASPRSPPVQPHTPVTISLGTAPSLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDANSSVLLSKTTAEKVDSVRNDHGGTVKKPQLNNKPQRPSQNGCQIRRHSGTGATPPVKKKPKLMSLKESSMADASKHGVGTESLFFDKVRKALRSAEAYENFLRCLVIFNQEVISRAELVQLVSPFLGKFPELFNWFKNFLGYKESVHLESFPKERATEGIAMEIDYASCKRLGSSYRALPKSYQQPKCTGRTPLCKEVLNDTWVSFPSWSEDSTFVSSKKTQYEEHIYRCEDERFELDVVLETNLATIRVLEAIQKKLSRLSAEEQAKFRLDNTLGGTSEVIHRKALQRIYADKAADIIDGLRKNPSIAVPIVLKRLKMKEEEWREAQRGFNKVWREQNEKYYLKSLDHQGINFKQNDTKVLRSKSLLNEIESIYDERQEQATEENAGVPVGPHLSLAYEDKQILEDAAALIIHHVKRQTGIQKEDKYKIKQIMHHFIPDLLFAQRGDLSDVEEEEEEEMDVDEATGAPKKHNGVGGSPPKSKLLFSNTAAQKLRGMDEVYNLFYVNNNWYIFMRLHQILCLRLLRICSQAERQIEEENREREWEREVLGIKRDKSDSPAIQLRLKEPMDVDVEDYYPAFLDMVRSLLDGNIDSSQYEDSLREMFTIHAYIAFTMDKLIQSIVRQLQHIVSDEVCVQVTDLYLAENNNGATGGQLNSQTSRSLLESAYQRKAEQLMSDENCFKLMFIQSQGQVQLTVELLDTEEENSDDPVEAERWSDYVERYMSSDTTSPELREHLAQKPVFLPRNLRRIRKCQRGREQQEKEGKEGNSKKTMENVESLDKLECRFKLNSYKMVYVIKSEDYMYRRTALLRAHQSHERVSKRLHQRFQAWVDKWTKEHVPREMAAETSKWLMGEGLEGLVPCTTTCDTETLHFVSINKYRVKYGTVFKAP gemi_mouse Geminin Gmnn protein protein mouse Mus musculus Mouse MNLSMKQKQEGAQENVKNSPVPRRTLKMIQPSADGSLVGRENELPKGLFKRKLWDDQLASQTSSCGPEANENKDVGDLTQEAFDLISKENPSSQYWKEVAEQRRKALYEALKENEKLHKEIEQKDSEIARLRKENKDLAEVAEHVQYMAEVIERLSNEPLDNFESPDSQEFDSEEEAVEYSELEDSGAGTCAEETVSSSTDARPCT ncor1_mouse Nuclear receptor corepressor 1 Ncor1 Rxrip13 Retinoid X receptor-interacting protein 13 protein protein mouse Mus musculus Mouse MSSSGYPPNQGAFSTEQSRYPSHSVQYTFPSARHQQEFAVPDYRSSHLEVSQASQLLQQQQQQQLRRRPSLLSEFHPGSDRPQERRSGYEQFHPGPSPVDHDSLESKRPRLEQVSDSHFQRISAAVLPLVHTLPEGLRSSANAKKDPAFGVKHEAPSSPLSGQPCGDDQNASPSKLSKEELIQSMDRVDREIAKVEQQILKLKKKQQQLEEEAAKPPEPEKPVSPPPVEQKHRSIVQIIYDENRKKAEEAHKIFEGLGPKVELPLYNQPSDTKVYHENIKTNQVMRKKLILFFKRRNHARKQREQKICQRYDQLMEAWEKKVDRIENNPRRKAKESKTREYYEKQFPEIRKQREQQERFQRVGQRGAGLSATIARSEHEISEIIDGLSEQENNEKQMRQLSVIPPMMFDAEQRRVKFINMNGLMEDPMKVYKDRQFMNVWTDHEKEIFKDKFIQHPKNFGLIASYLERKSVPDCVLYYYLTKKNENYKALVRRNYGKRRGRNQQIARPSQEEKVEEKEEDKAEKTEKKEEEKKDDEEKDDKEDSKETTKEKDRTEATAEEPEEREQVTPRGRKTANSQGRGKGRVTRSMTSEAAAANAAAAATEEPPPPLPPPPEPISTEPVETSRWTEEEMEVAKKGLVEHGRNWAAIAKMVGTKSEAQCKNFYFNYKRRHNLDNLLQQHKQKASRKPREERDVSQCESVASTVSAQEDEDIEASNEEENPEDSEGAENSSDTESAPSPSPVEAAKSSEDSSENAASRGNTEPVAELEATTDPAPCASPSSAVPTTKPAERESVEAQVTDSASAETAEPMDVDHEECGAEGSSVLDPPAPTKADSVDPEMQVPENTASKGEGDAKERDLESTSEKTEARDEDVVVAEQIERPEPQSDDDSSATCSADEGVDGEPERQRVFPMDAKPSLLTPPGSILISSPIKPNLLDLPQLQHRAAVIPPMVSCTPCNIPIGTPVSGYALYQRHIKAMHESALLEEQRQRQEQVDLECRSSTSPCSTSKSPNREWEVLQPAPHQVITNLPEGVRLPTTRPTRPPPPLIPSSKTTVASEKPSFIMGGSISQGTPGTYLSSHNQAYPQEAPKPSVGSISLGLPRQQESTKAAPLTYIKQEEFSPRSQNSQPEGLLVRAQHEGVVRGTAGAVQEGSITRGTPASKISVETISSLRGSITQGTPALPQAGIPTEALVKGPVSRMPIEESSPEKVREEAASKGHVIYEGKSGHILSYDNIKNAREGTRSPRTAHEMSLKRSYEAVEGSIKQGMSMRESPVSAPLEGLICRALPRGSPHSDLKERTVLSGSIMQGTPRATAESFEDGLKYPKQIKRESPPIRAFEGAITKGKPYDGITTIKEMGRSIHEIPRQDILTQESRKTPEVVQSTRPIIEGSISQGTPIKFDNNSGQSAIKHNVKSLITGPSKLPRGMLEIVPENIKVVERGKYEDVKAGEPVRARHTSVVSSGPSVLRSTLHEAPKAQLSPGLYDDSSARRTPVSYQNTISRGSPMMNRTSDVSSSKSASHERKSTLTPTQRESIPAKSPVPGVDPIVSHSPFDPHHRSSAAGEVYRSHLPTHLDPAMPFHRALDPAAAYLLQRQLSPTPGYPSQYQLYAMENTRQTILNDYITSQQMQVNLRPDVTRGLSPREQPLGLPYPATRGIIDLTNMPPTILVPHAGGTSTPPMDRITYIPGTQVTFPPRPYNAASLSPGHPTHLAAAASAEREREREREKERERERERERERERERIAAAPADLYLRPGSEQPGRPGSHGYVRSPSPSVRTQETILQQRPSVFQGTNGTSVITPLDPTAQLRIMPLPSGGPSISQGLPASRYNTAADALAALVDAAASAPQMDVSKTKESKHEAARLEENLRSRSAAVSEQQQLEQKNLEVEKRSVQCVCTSSALPSGKAQPHASVVYSEAGKDKGPPPKSRYEEELRTRGKTTITAANFIDVIITRQIASDKDARERGSQSSDSSSSLSSHRYETASDAIEVISPASSPAPPQEKPQAYQPDMVKANQAENESTRQYEGPLHHYRSQQESPSPQQQPPLPPSSQSEGMGQVPRTHRLITLADHICQIITQDFARNQVPSQASTSTFQTSPSALSSTPVRTKTSSRYSPESQSQTVLHPRPGPRVSPENLVDKSRGSRPGKSPERSHIPSEPYEPISPPQGPAVHEKQDSMLLLSQRGVDPAEQRSDSRSPGSISYLPSFFTKLESTSPMVKSKKQEIFRKLNSSGGGDSDMAAAQPGTEIFNLPAVTTSGAVSSRSHSFADPASNLGLEDIIRKALMGSFDDKVEDHGVVMSHPVGIMPGSASTSVVTSSEARRDEGEPSPHAGVCKPKLINKSNSRKSKSPIPGQSYLGTERPSSVSSVHSEGDYHRQTPGWAWEDRPSSTGSTQFPYNPLTIRMLSSTPPTQIACAPSAITQAAPHQQNRIWEREPAPLLSAQYETLSDSDD tfap4-gem-1 3147180 N/A 3147193 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3147194 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false ncor2-tfap4-1 3147181 N/A 3147195 unspecified role unspecified role prey prey in vitro In vitro N/A 3147196 unspecified role unspecified role bait bait Region 1059-1495 Region 1059-1495 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro direct interaction direct interaction false false false hdac3-gem-1 3147182 N/A 3147193 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3147194 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3147196 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3147197 unspecified role unspecified role bait bait human Homo sapiens Human association association false false false gem-tfap4-1 3147183 N/A 3147194 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3147193 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false sin3a-tfap4-1 3147184 N/A 3147198 unspecified role unspecified role bait bait Region 1-479 Region 1-479 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro N/A 3147195 unspecified role unspecified role prey prey in vitro In vitro direct interaction direct interaction false false false tfap4-gmnn-1 3147185 N/A 3147199 unspecified role unspecified role prey prey in vitro In vitro N/A 3147195 unspecified role unspecified role bait bait Region 99-186 Region 99-186 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro direct interaction direct interaction false false false ncor2-gem-1 3147186 N/A 3147193 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3147196 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false ncor1-tfap4-1 3147187 N/A 3147200 unspecified role unspecified role bait bait Region 1986-2443 Region 1986-2443 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro N/A 3147195 unspecified role unspecified role prey prey in vitro In vitro direct interaction direct interaction false false false tfap4-gmnn-2 3147188 N/A 3147199 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Region 95-209 Region 95-209 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 3147195 unspecified role unspecified role bait bait Region 99-186 Region 99-186 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro direct interaction direct interaction false false false gmnn-ncor2-1 3147189 N/A 3147196 unspecified role unspecified role prey prey Region 1059-1495 Region 1059-1495 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3147199 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false ncor2-gmnn-1 3147190 N/A 3147196 unspecified role unspecified role bait bait in vitro In vitro N/A 3147199 unspecified role unspecified role prey prey in vitro In vitro direct interaction direct interaction false false false ncor2-gmnn-2 3147191 N/A 3147196 unspecified role unspecified role bait bait Region 1059-1495 Region 1059-1495 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro N/A 3147199 unspecified role unspecified role prey prey in vitro In vitro direct interaction direct interaction false false false tfap4-gem-2 3147192 N/A 3147193 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3147195 unspecified role unspecified role bait bait Region 99-186 Region 99-186 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false