DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ compaan-2006-1 trini Trichoplusia ni (Cabbage looper) Cabbage looper molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Compaan DM., Hymowitz SG. DIP original experiment: DIP-66340X Structure (London, England : 1993) 2006 IMEx The crystal structure of the costimulatory OX40-OX40L complex. Compaan DM., Hymowitz SG. Only protein-protein interactions imex curation compaan-2006-2 trini Trichoplusia ni (Cabbage looper) Cabbage looper x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Compaan DM., Hymowitz SG. DIP original experiment: DIP-66336X Structure (London, England : 1993) 2006 IMEx The crystal structure of the costimulatory OX40-OX40L complex. Compaan DM., Hymowitz SG. Only protein-protein interactions imex curation compaan-2006-3 trini Trichoplusia ni (Cabbage looper) Cabbage looper x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Compaan DM., Hymowitz SG. DIP original experiment: DIP-66337X Structure (London, England : 1993) 2006 IMEx The crystal structure of the costimulatory OX40-OX40L complex. Compaan DM., Hymowitz SG. Only protein-protein interactions imex curation compaan-2006-4 trini Trichoplusia ni (Cabbage looper) Cabbage looper molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Compaan DM., Hymowitz SG. DIP original experiment: DIP-66339X Structure (London, England : 1993) 2006 IMEx The crystal structure of the costimulatory OX40-OX40L complex. Compaan DM., Hymowitz SG. Only protein-protein interactions imex curation compaan-2006-5 trini Trichoplusia ni (Cabbage looper) Cabbage looper x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Compaan DM., Hymowitz SG. DIP original experiment: DIP-66338X Structure (London, England : 1993) 2006 IMEx The crystal structure of the costimulatory OX40-OX40L complex. Compaan DM., Hymowitz SG. Only protein-protein interactions imex curation tnr4_human Tumor necrosis factor receptor superfamily member 4 ACT35 antigen OX40L receptor TAX transcriptionally-activated glycoprotein 1 receptor TNFRSF4 TXGP1L protein protein human Homo sapiens Human MCVGARRLGRGPCAALLLLGLGLSTVTGLHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVAAILGLGLVLGLLGPLAILLALYLLRRDQRLPPDAHKPPGGGSFRTPIQEEQADAHSTLAKI tnfl4_human Tumor necrosis factor ligand superfamily member 4 TNFSF4 TXGP1 Glycoprotein Gp34 OX40 ligand TAX transcriptionally-activated glycoprotein 1 protein protein human Homo sapiens Human MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL tnfl4_mouse Tumor necrosis factor ligand superfamily member 4 OX40 ligand Tnfsf4 Ox40l Txgp1l protein protein mouse Mus musculus Mouse MEGEGVQPLDENLENGSRPRFKWKKTLRLVVSGIKGAGMLLCFIYVCLQLSSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL tnfrsf4-tnfsf4-1 3146885 N/A 3146890 unspecified role unspecified role unspecified role unspecified role Binding region 51-183 Binding region 51-183 sufficient to bind sufficient binding region sufficient to bind x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3146891 unspecified role unspecified role unspecified role unspecified role Binding region 29-170 Binding region 29-170 sufficient to bind sufficient binding region sufficient to bind x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false tnfsf4-1 3146886 N/A 3146892 unspecified role unspecified role unspecified role unspecified role Region 51-198 Region 51-198 sufficient to bind sufficient binding region sufficient to bind x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false tnfsf4-tnfsf4-1 3146887 N/A 3146891 unspecified role unspecified role unspecified role unspecified role Binding region 29-170 Binding region 29-170 sufficient to bind sufficient binding region sufficient to bind x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3146892 unspecified role unspecified role unspecified role unspecified role Binding region 51-198 Binding region 51-198 sufficient to bind sufficient binding region sufficient to bind x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false tnfsf4-tnfsf4-2 3146888 N/A 3146891 unspecified role unspecified role unspecified role unspecified role Binding region 29-170 Binding region 29-170 sufficient to bind sufficient binding region sufficient to bind x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3146892 unspecified role unspecified role unspecified role unspecified role Binding region 51-198 Binding region 51-198 sufficient to bind sufficient binding region sufficient to bind x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false tnfrsf4-tnfsf4-2 3146889 N/A 3146890 unspecified role unspecified role unspecified role unspecified role Binding region 51-183 Binding region 51-183 sufficient to bind sufficient binding region sufficient to bind x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3146891 unspecified role unspecified role unspecified role unspecified role Binding region 29-170 Binding region 29-170 sufficient to bind sufficient binding region sufficient to bind x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain false trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false