DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ park-2006-14 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Park SY., Lowder B., Bilwes AM., Blair DF., Crane BR. DIP original experiment: DIP-263484X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structure of FliM provides insight into assembly of the switch complex in the bacterial flagella motor. Park SY., Lowder B., Bilwes AM., Blair DF., Crane BR. Only protein-protein interactions imex curation park-2006-15 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Park SY., Lowder B., Bilwes AM., Blair DF., Crane BR. DIP original experiment: DIP-263485X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structure of FliM provides insight into assembly of the switch complex in the bacterial flagella motor. Park SY., Lowder B., Bilwes AM., Blair DF., Crane BR. Only protein-protein interactions imex curation flim_thema Flagellar motor switch protein FliM fliM TM_0679 protein protein thema Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) MSDVLSQEEINQLIEALMKGELKEEDLLKEEEEKKVKPYDFKRPSKFSKEQLRTFQMIHENFGRALSTYLSGRLRTFVDVEISIDQLTYEEFIRSVMIPSFIVIFTGDVFEGSAIFEMRLDLFYTMLDIIMGGPGENPPNRPPTEIETSIMRKEVTNMLTLLAQAWSDFQYFIPSIENVETNPQFVQIVPPNEIVLLVTASVSWGEFTSFINVCWPFSLLEPLLEKLSDRFWMMGRKPEKVEERMEELRKASQKIPVTVQAVIGETELRLKEILDLEVGDVIRLGTHYKDEIRIDVEGRPKFRGIPGVFKGKYAVKVTGEFTNGGEYE mint chey_thema Chemotaxis protein CheY cheY TM_0700 protein protein thema Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) MGKRVLIVDDAAFMRMMLKDIITKAGYEVAGEATNGREAVEKYKELKPDIVTMDITMPEMNGIDAIKEIMKIDPNAKIIVCSAMGQQAMVIEAIKAGAKDFIVKPFQPSRVVEALNKVSK chey-flim-1 3146545 N/A 3146547 unspecified role unspecified role unspecified role unspecified role Region 1-249 Region 1-249 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3146548 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false chey-flim-2 3146546 N/A 3146547 unspecified role unspecified role unspecified role unspecified role Region 1-249 Region 1-249 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3146548 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false