DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ schaub-2006-1 in vitro In vitro density sedimentation cosedimentation through density gradient density sedimentation predetermined predetermined participant predetermined Schaub JR., Lu X., Doneske B., Shin YK., McNew JA. DIP original experiment: DIP-66540X Nature structural & molecular biology 2006 IMEx Hemifusion arrest by complexin is relieved by Ca2+-synaptotagmin I. Schaub JR., Lu X., Doneske B., Shin YK., McNew JA. Only protein-protein interactions imex curation schaub-2006-2 in vitro In vitro density sedimentation cosedimentation through density gradient density sedimentation predetermined predetermined participant predetermined Schaub JR., Lu X., Doneske B., Shin YK., McNew JA. DIP original experiment: DIP-66541X Nature structural & molecular biology 2006 IMEx Hemifusion arrest by complexin is relieved by Ca2+-synaptotagmin I. Schaub JR., Lu X., Doneske B., Shin YK., McNew JA. Only protein-protein interactions imex curation stx1a_rat Syntaxin-1A Synaptotagmin-associated 35 kDa protein Neuron-specific antigen HPC-1 Stx1a Sap protein protein rat Rattus norvegicus (Rat) Rat MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIIIASTIGGIFG vamp2_mouse Vesicle-associated membrane protein 2 Vamp2 Syb2 Synaptobrevin-2 protein protein mouse Mus musculus Mouse MSATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST snp25_mouse Synaptosomal-associated protein 25 Synaptosomal-associated 25 kDa protein Super protein Snap25 Snap protein protein mouse Mus musculus Mouse MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG q8ipm8-1 Complexin cpx CG32490 G H I protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAAFIAKQMVGNQLSAVKGAVGGDGGDDGDDKEKAEEEERERQEAIKEAEDRRKEKHRKMEEEREKMRQDIRDKYNIKKKEEIVEAAPQEEPNPLMRKKKTPEELAAEAEQEELDDFTKLKNQIETQVNELKTQIEGKCVMQ No experimental confirmation available. syt1_rat Synaptotagmin-1 Syt1 Synaptotagmin I p65 protein protein rat Rattus norvegicus (Rat) Rat MVSASHPEALAAPVTTVATLVPHNATEPASPGEGKEDAFSKLKQKFMNELHKIPLPPWALIAIAIVAVLLVVTCCFCVCKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK cpx-snap25-1 3145827 N/A 3145829 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli N/A 3145830 unspecified role unspecified role neutral component neutral component 1-93 binding region 1-93 binding region sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3145831 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli N/A 3145832 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli physical association physical association false false false cpx-snap25-2 3145828 N/A 3145833 unspecified role unspecified role neutral component neutral component 140-421 binding region 140-421 binding region sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3145830 unspecified role unspecified role neutral component neutral component 1-93 binding region 1-93 binding region sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3145831 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli N/A 3145829 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli N/A 3145832 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli physical association physical association false false false