DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ white-2006-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined White HE., Orlova EV., Chen S., Wang L., Ignatiou A., Gowen B., Stromer T., Franzmann TM., Haslbeck M., Buchner J., Saibil HR. DIP original experiment: DIP-66326X Structure (London, England : 1993) 2006 IMEx Multiple distinct assemblies reveal conformational flexibility in the small heat shock protein Hsp26. White HE., Orlova EV., Chen S., Wang L., Ignatiou A., Gowen B., Stromer T., Franzmann TM., Haslbeck M., Buchner J., Saibil HR. Only protein-protein interactions imex curation hsp26_yeast Heat shock protein 26 HSP26 YBR072W YBR0714 26 kDa heat shock protein protein protein yeast Saccharomyces cerevisiae Baker's yeast MSFNSPFFDFFDNINNEVDAFNRLLGEGGLRGYAPRRQLANTPAKDSTGKEVARPNNYAGALYDPRDETLDDWFDNDLSLFPSGFGFPRSVAVPVDILDHDNNYELKVVVPGVKSKKDIDIEYHQNKNQILVSGEIPSTLNEESKDKVKVKESSSGKFKRVITLPDYPGVDADNIKADYANGVLTLTVPKLKPQKDGKNHVKKIEVSSQESWGN 0CB8B6BD22C5308F hsp26-1 3145803 N/A 3145804 unspecified role unspecified role neutral component neutral component yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false