DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ zikowska-2006-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ziółkowska NE., O'Keefe BR., Mori T., Zhu C., Giomarelli B., Vojdani F., Palmer KE., McMahon JB., Wlodawer A. DIP original experiment: DIP-132714X Structure (London, England : 1993) 2006 IMEx Domain-swapped structure of the potent antiviral protein griffithsin and its mode of carbohydrate binding. Ziółkowska NE., O'Keefe BR., Mori T., Zhu C., Giomarelli B., Vojdani F., Palmer KE., McMahon JB., Wlodawer A. Only protein-protein interactions imex curation grfin_grisq Griffithsin protein protein grisq Griffithsia sp. (strain Q66D336) SLTHRKFGGSGGSPFSGLSSIAVRSGSYLDXIIIDGVHHGGSGGNLSPTFTFGSGEYISNMTIRSGDYIDNISFETNMGRRFGPYGGSGGSANTLSNVKVIQINGSAGDYLDSLDIYYEQY mint grfin_grisq-1 3145741 N/A 3145742 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false