DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ savi-2006-1 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Savi P., Zachayus JL., Delesque-Touchard N., Labouret C., Hervé C., Uzabiaga MF., Pereillo JM., Culouscou JM., Bono F., Ferrara P., Herbert JM. DIP original experiment: DIP-263397X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The active metabolite of Clopidogrel disrupts P2Y12 receptor oligomers and partitions them out of lipid rafts. Savi P., Zachayus JL., Delesque-Touchard N., Labouret C., Hervé C., Uzabiaga MF., Pereillo JM., Culouscou JM., Bono F., Ferrara P., Herbert JM. Only protein-protein interactions imex curation p2y12_human P2Y purinoceptor 12 P2RY12 HORK3 ADP-glucose receptor P2T(AC) P2Y(AC) P2Y(cyc) P2Y12 platelet ADP receptor SP1999 protein protein human Homo sapiens Human MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM p2ry12-p2ry12-1 3145734 N/A 3145735 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3145735 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false