DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ iniesta-2006-1 cauce Caulobacter crescentus Caulobacter crescentus anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Iniesta AA., McGrath PT., Reisenauer A., McAdams HH., Shapiro L. DIP original experiment: DIP-263354X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A phospho-signaling pathway controls the localization and activity of a protease complex critical for bacterial cell cycle progression. Iniesta AA., McGrath PT., Reisenauer A., McAdams HH., Shapiro L. Only protein-protein interactions imex curation iniesta-2006-2 cauce Caulobacter crescentus Caulobacter crescentus anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Iniesta AA., McGrath PT., Reisenauer A., McAdams HH., Shapiro L. DIP original experiment: DIP-263355X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A phospho-signaling pathway controls the localization and activity of a protease complex critical for bacterial cell cycle progression. Iniesta AA., McGrath PT., Reisenauer A., McAdams HH., Shapiro L. Only protein-protein interactions imex curation clpx_cauvc ATP-dependent Clp protease ATP-binding subunit ClpX clpX CC_1961 protein protein caucr Caulobacter crescentus (strain ATCC 19089 / CB15) Caulobacter vibrioides MTKAASGDTKSTLYCSFCGKSQHEVRKLIAGPTVFICDECVELCMDIIREEHKIAFVKSKDGVPTPREICEVLDDYVIGQGHAKKVLAVAVHNHYKRLNHASKNNDVELAKSNILLVGPTGTGKTLLAQTLARIIDVPFTMADATTLTEAGYVGEDVENIVLKLLQAADYNVERAQRGIVYIDEIDKISRKSDNPSITRDVSGEGVQQALLKIMEGTVASVPPQGGRKHPQQEFLQVDTTNILFICGGAFAGLEKIISARGAAKSIGFGAKVTDPEERRTGEILRNVEPDDLQRFGLIPEFIGRLPVVATLEDLDEAALVKILTEPKNAFVKQYQRLFEMENIGLTFTEDALHQVAKKAIARKTGARGLRSIMEGILLETMFELPTYEGVEEVVVNAEVVEGRAQPLLIYAEKKGGAASA q9aa62_cauvc cpdR CC_0744 protein protein caucr Caulobacter crescentus (strain ATCC 19089 / CB15) Caulobacter vibrioides MARILLAEDDDSLRGFLARALERAGFEVQACADGEEAVQHLDHPWDLLLTDIVMPGMDGIEVARQAAARDPSLRIMFITGFAAVALSAQDRAPAGAKVLSKPVHLRDLVAEVEKMMAA clpp_cauvc ATP-dependent Clp protease proteolytic subunit clpP Endopeptidase Clp CC_1963 protein protein caucr Caulobacter crescentus (strain ATCC 19089 / CB15) Caulobacter vibrioides MYDPVSTAMNLVPMVVEQTSRGERAFDIFSRLLKERIIFLTGPVEDGMASLICAQLLFLESENPKKEIAMYINSPGGVVTAGLAIYDTMQYIKSPVSTVCMGMAASMGSLLLAAGAAGQRISLPNARIMVHQPSGGFRGQASDIERHAEDIIKTKRRLNEIYVKHCGRTYEEVERTLDRDHFMSADEAKAWGLVDHVYDSRDAAEAGAE cpdr-clpx-1 3145631 N/A 3145633 unspecified role unspecified role prey prey cauce Caulobacter crescentus Caulobacter crescentus N/A 3145634 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false cauce Caulobacter crescentus Caulobacter crescentus physical association physical association false false false cpdr-clpp-1 3145632 N/A 3145635 unspecified role unspecified role prey prey cauce Caulobacter crescentus Caulobacter crescentus N/A 3145634 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false cauce Caulobacter crescentus Caulobacter crescentus physical association physical association false false false