DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ yang-2006-8 in vitro In vitro pull down pull down autoradiography autoradiography Yang F., Vought BW., Satterlee JS., Walker AK., Jim Sun ZY., Watts JL., DeBeaumont R., Saito RM., Hyberts SG., Yang S., Macol C., Iyer L., Tjian R., van den Heuvel S., Hart AC., Wagner G., Näär AM. DIP original experiment: DIP-254896X Nature 2006 IMEx An ARC/Mediator subunit required for SREBP control of cholesterol and lipid homeostasis. Yang F., Vought BW., Satterlee JS., Walker AK., Jim Sun ZY., Watts JL., DeBeaumont R., Saito RM., Hyberts SG., Yang S., Macol C., Iyer L., Tjian R., van den Heuvel S., Hart AC., Wagner G., Näär AM. Only protein-protein interactions imex curation yang-2006-9 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Yang F., Vought BW., Satterlee JS., Walker AK., Jim Sun ZY., Watts JL., DeBeaumont R., Saito RM., Hyberts SG., Yang S., Macol C., Iyer L., Tjian R., van den Heuvel S., Hart AC., Wagner G., Näär AM. DIP original experiment: DIP-254906X Nature 2006 IMEx An ARC/Mediator subunit required for SREBP control of cholesterol and lipid homeostasis. Yang F., Vought BW., Satterlee JS., Walker AK., Jim Sun ZY., Watts JL., DeBeaumont R., Saito RM., Hyberts SG., Yang S., Macol C., Iyer L., Tjian R., van den Heuvel S., Hart AC., Wagner G., Näär AM. Only protein-protein interactions imex curation yang-2006-10 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Yang F., Vought BW., Satterlee JS., Walker AK., Jim Sun ZY., Watts JL., DeBeaumont R., Saito RM., Hyberts SG., Yang S., Macol C., Iyer L., Tjian R., van den Heuvel S., Hart AC., Wagner G., Näär AM. DIP original experiment: DIP-254910X Nature 2006 IMEx An ARC/Mediator subunit required for SREBP control of cholesterol and lipid homeostasis. Yang F., Vought BW., Satterlee JS., Walker AK., Jim Sun ZY., Watts JL., DeBeaumont R., Saito RM., Hyberts SG., Yang S., Macol C., Iyer L., Tjian R., van den Heuvel S., Hart AC., Wagner G., Näär AM. Only protein-protein interactions imex curation yang-2006-11 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Yang F., Vought BW., Satterlee JS., Walker AK., Jim Sun ZY., Watts JL., DeBeaumont R., Saito RM., Hyberts SG., Yang S., Macol C., Iyer L., Tjian R., van den Heuvel S., Hart AC., Wagner G., Näär AM. DIP original experiment: DIP-254902X Nature 2006 IMEx An ARC/Mediator subunit required for SREBP control of cholesterol and lipid homeostasis. Yang F., Vought BW., Satterlee JS., Walker AK., Jim Sun ZY., Watts JL., DeBeaumont R., Saito RM., Hyberts SG., Yang S., Macol C., Iyer L., Tjian R., van den Heuvel S., Hart AC., Wagner G., Näär AM. Only protein-protein interactions imex curation yang-2006-12 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Yang F., Vought BW., Satterlee JS., Walker AK., Jim Sun ZY., Watts JL., DeBeaumont R., Saito RM., Hyberts SG., Yang S., Macol C., Iyer L., Tjian R., van den Heuvel S., Hart AC., Wagner G., Näär AM. DIP original experiment: DIP-254913X Nature 2006 IMEx An ARC/Mediator subunit required for SREBP control of cholesterol and lipid homeostasis. Yang F., Vought BW., Satterlee JS., Walker AK., Jim Sun ZY., Watts JL., DeBeaumont R., Saito RM., Hyberts SG., Yang S., Macol C., Iyer L., Tjian R., van den Heuvel S., Hart AC., Wagner G., Näär AM. Only protein-protein interactions imex curation yang-2006-13 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Yang F., Vought BW., Satterlee JS., Walker AK., Jim Sun ZY., Watts JL., DeBeaumont R., Saito RM., Hyberts SG., Yang S., Macol C., Iyer L., Tjian R., van den Heuvel S., Hart AC., Wagner G., Näär AM. DIP original experiment: DIP-254907X Nature 2006 IMEx An ARC/Mediator subunit required for SREBP control of cholesterol and lipid homeostasis. Yang F., Vought BW., Satterlee JS., Walker AK., Jim Sun ZY., Watts JL., DeBeaumont R., Saito RM., Hyberts SG., Yang S., Macol C., Iyer L., Tjian R., van den Heuvel S., Hart AC., Wagner G., Näär AM. Only protein-protein interactions imex curation yang-2006-14 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Yang F., Vought BW., Satterlee JS., Walker AK., Jim Sun ZY., Watts JL., DeBeaumont R., Saito RM., Hyberts SG., Yang S., Macol C., Iyer L., Tjian R., van den Heuvel S., Hart AC., Wagner G., Näär AM. DIP original experiment: DIP-254897X Nature 2006 IMEx An ARC/Mediator subunit required for SREBP control of cholesterol and lipid homeostasis. Yang F., Vought BW., Satterlee JS., Walker AK., Jim Sun ZY., Watts JL., DeBeaumont R., Saito RM., Hyberts SG., Yang S., Macol C., Iyer L., Tjian R., van den Heuvel S., Hart AC., Wagner G., Näär AM. Only protein-protein interactions imex curation yang-2006-15 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Yang F., Vought BW., Satterlee JS., Walker AK., Jim Sun ZY., Watts JL., DeBeaumont R., Saito RM., Hyberts SG., Yang S., Macol C., Iyer L., Tjian R., van den Heuvel S., Hart AC., Wagner G., Näär AM. DIP original experiment: DIP-254900X Nature 2006 IMEx An ARC/Mediator subunit required for SREBP control of cholesterol and lipid homeostasis. Yang F., Vought BW., Satterlee JS., Walker AK., Jim Sun ZY., Watts JL., DeBeaumont R., Saito RM., Hyberts SG., Yang S., Macol C., Iyer L., Tjian R., van den Heuvel S., Hart AC., Wagner G., Näär AM. Only protein-protein interactions imex curation yang-2006-16 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Yang F., Vought BW., Satterlee JS., Walker AK., Jim Sun ZY., Watts JL., DeBeaumont R., Saito RM., Hyberts SG., Yang S., Macol C., Iyer L., Tjian R., van den Heuvel S., Hart AC., Wagner G., Näär AM. DIP original experiment: DIP-254909X Nature 2006 IMEx An ARC/Mediator subunit required for SREBP control of cholesterol and lipid homeostasis. Yang F., Vought BW., Satterlee JS., Walker AK., Jim Sun ZY., Watts JL., DeBeaumont R., Saito RM., Hyberts SG., Yang S., Macol C., Iyer L., Tjian R., van den Heuvel S., Hart AC., Wagner G., Näär AM. Only protein-protein interactions imex curation yang-2006-17 in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Yang F., Vought BW., Satterlee JS., Walker AK., Jim Sun ZY., Watts JL., DeBeaumont R., Saito RM., Hyberts SG., Yang S., Macol C., Iyer L., Tjian R., van den Heuvel S., Hart AC., Wagner G., Näär AM. DIP original experiment: DIP-254903X Nature 2006 IMEx An ARC/Mediator subunit required for SREBP control of cholesterol and lipid homeostasis. Yang F., Vought BW., Satterlee JS., Walker AK., Jim Sun ZY., Watts JL., DeBeaumont R., Saito RM., Hyberts SG., Yang S., Macol C., Iyer L., Tjian R., van den Heuvel S., Hart AC., Wagner G., Näär AM. Only protein-protein interactions imex curation yang-2006-18 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Yang F., Vought BW., Satterlee JS., Walker AK., Jim Sun ZY., Watts JL., DeBeaumont R., Saito RM., Hyberts SG., Yang S., Macol C., Iyer L., Tjian R., van den Heuvel S., Hart AC., Wagner G., Näär AM. DIP original experiment: DIP-254912X Nature 2006 IMEx An ARC/Mediator subunit required for SREBP control of cholesterol and lipid homeostasis. Yang F., Vought BW., Satterlee JS., Walker AK., Jim Sun ZY., Watts JL., DeBeaumont R., Saito RM., Hyberts SG., Yang S., Macol C., Iyer L., Tjian R., van den Heuvel S., Hart AC., Wagner G., Näär AM. Only protein-protein interactions imex curation yang-2006-19 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Yang F., Vought BW., Satterlee JS., Walker AK., Jim Sun ZY., Watts JL., DeBeaumont R., Saito RM., Hyberts SG., Yang S., Macol C., Iyer L., Tjian R., van den Heuvel S., Hart AC., Wagner G., Näär AM. DIP original experiment: DIP-254908X Nature 2006 IMEx An ARC/Mediator subunit required for SREBP control of cholesterol and lipid homeostasis. Yang F., Vought BW., Satterlee JS., Walker AK., Jim Sun ZY., Watts JL., DeBeaumont R., Saito RM., Hyberts SG., Yang S., Macol C., Iyer L., Tjian R., van den Heuvel S., Hart AC., Wagner G., Näär AM. Only protein-protein interactions imex curation yang-2006-20 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Yang F., Vought BW., Satterlee JS., Walker AK., Jim Sun ZY., Watts JL., DeBeaumont R., Saito RM., Hyberts SG., Yang S., Macol C., Iyer L., Tjian R., van den Heuvel S., Hart AC., Wagner G., Näär AM. DIP original experiment: DIP-254898X Nature 2006 IMEx An ARC/Mediator subunit required for SREBP control of cholesterol and lipid homeostasis. Yang F., Vought BW., Satterlee JS., Walker AK., Jim Sun ZY., Watts JL., DeBeaumont R., Saito RM., Hyberts SG., Yang S., Macol C., Iyer L., Tjian R., van den Heuvel S., Hart AC., Wagner G., Näär AM. Only protein-protein interactions imex curation yang-2006-21 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Yang F., Vought BW., Satterlee JS., Walker AK., Jim Sun ZY., Watts JL., DeBeaumont R., Saito RM., Hyberts SG., Yang S., Macol C., Iyer L., Tjian R., van den Heuvel S., Hart AC., Wagner G., Näär AM. DIP original experiment: DIP-254904X Nature 2006 IMEx An ARC/Mediator subunit required for SREBP control of cholesterol and lipid homeostasis. Yang F., Vought BW., Satterlee JS., Walker AK., Jim Sun ZY., Watts JL., DeBeaumont R., Saito RM., Hyberts SG., Yang S., Macol C., Iyer L., Tjian R., van den Heuvel S., Hart AC., Wagner G., Näär AM. Only protein-protein interactions imex curation yang-2006-22 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Yang F., Vought BW., Satterlee JS., Walker AK., Jim Sun ZY., Watts JL., DeBeaumont R., Saito RM., Hyberts SG., Yang S., Macol C., Iyer L., Tjian R., van den Heuvel S., Hart AC., Wagner G., Näär AM. DIP original experiment: DIP-254905X Nature 2006 IMEx An ARC/Mediator subunit required for SREBP control of cholesterol and lipid homeostasis. Yang F., Vought BW., Satterlee JS., Walker AK., Jim Sun ZY., Watts JL., DeBeaumont R., Saito RM., Hyberts SG., Yang S., Macol C., Iyer L., Tjian R., van den Heuvel S., Hart AC., Wagner G., Näär AM. Only protein-protein interactions imex curation yang-2006-23 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Yang F., Vought BW., Satterlee JS., Walker AK., Jim Sun ZY., Watts JL., DeBeaumont R., Saito RM., Hyberts SG., Yang S., Macol C., Iyer L., Tjian R., van den Heuvel S., Hart AC., Wagner G., Näär AM. DIP original experiment: DIP-254901X Nature 2006 IMEx An ARC/Mediator subunit required for SREBP control of cholesterol and lipid homeostasis. Yang F., Vought BW., Satterlee JS., Walker AK., Jim Sun ZY., Watts JL., DeBeaumont R., Saito RM., Hyberts SG., Yang S., Macol C., Iyer L., Tjian R., van den Heuvel S., Hart AC., Wagner G., Näär AM. Only protein-protein interactions imex curation yang-2006-24 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Yang F., Vought BW., Satterlee JS., Walker AK., Jim Sun ZY., Watts JL., DeBeaumont R., Saito RM., Hyberts SG., Yang S., Macol C., Iyer L., Tjian R., van den Heuvel S., Hart AC., Wagner G., Näär AM. DIP original experiment: DIP-254911X Nature 2006 IMEx An ARC/Mediator subunit required for SREBP control of cholesterol and lipid homeostasis. Yang F., Vought BW., Satterlee JS., Walker AK., Jim Sun ZY., Watts JL., DeBeaumont R., Saito RM., Hyberts SG., Yang S., Macol C., Iyer L., Tjian R., van den Heuvel S., Hart AC., Wagner G., Näär AM. Only protein-protein interactions imex curation yang-2006-25 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Yang F., Vought BW., Satterlee JS., Walker AK., Jim Sun ZY., Watts JL., DeBeaumont R., Saito RM., Hyberts SG., Yang S., Macol C., Iyer L., Tjian R., van den Heuvel S., Hart AC., Wagner G., Näär AM. DIP original experiment: DIP-254899X Nature 2006 IMEx An ARC/Mediator subunit required for SREBP control of cholesterol and lipid homeostasis. Yang F., Vought BW., Satterlee JS., Walker AK., Jim Sun ZY., Watts JL., DeBeaumont R., Saito RM., Hyberts SG., Yang S., Macol C., Iyer L., Tjian R., van den Heuvel S., Hart AC., Wagner G., Näär AM. Only protein-protein interactions imex curation med15_human Mediator of RNA polymerase II transcription subunit 15 MED15 ARC105 CTG7A Mediator complex subunit 15 Positive cofactor 2 glutamine/Q-rich-associated protein TPA-inducible gene 1 protein Activator-recruited cofactor 105 kDa component CTG repeat protein 7a Trinucleotide repeat-containing gene 7 protein TIG1 PCQAP TNRC7 protein protein human Homo sapiens Human MDVSGQETDWRSTAFRQKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDIHNKKSQASVSDPMNALQSLTGGPAAGAAGIGMPPRGPGQSLGGMGSLGAMGQPMSLSGQPPPGTSGMAPHSMAVVSTATPQTQLQLQQVALQQQQQQQQFQQQQQAALQQQQQQQQQQQFQAQQSAMQQQFQAVVQQQQQLQQQQQQQQHLIKLHHQNQQQIQQQQQQLQRIAQLQLQQQQQQQQQQQQQQQQALQAQPPIQQPPMQQPQPPPSQALPQQLQQMHHTQHHQPPPQPQQPPVAQNQPSQLPPQSQTQPLVSQAQALPGQMLYTQPPLKFVRAPMVVQQPPVQPQVQQQQTAVQTAQAAQMVAPGVQMITEALAQGGMHIRARFPPTTAVSAIPSSSIPLGRQPMAQVSQSSLPMLSSPSPGQQVQTPQSMPPPPQPSPQPGQPSSQPNSNVSSGPAPSPSSFLPSPSPQPSQSPVTARTPQNFSVPSPGPLNTPVNPSSVMSPAGSSQAEEQQYLDKLKQLSKYIEPLRRMINKIDKNEDRKKDLSKMKSLLDILTDPSKRCPLKTLQKCEIALEKLKNDMAVPTPPPPPVPPTKQQYLCQPLLDAVLANIRSPVFNHSLYRTFVPAMTAIHGPPITAPVVCTRKRRLEDDERQSIPSVLQGEVARLDPKFLVNLDPSHCSNNGTVHLICKLDDKDLPSVPPLELSVPADYPAQSPLWIDRQWQYDANPFLQSVHRCMTSRLLQLPDKHSVTALLNTWAQSVHQACLSAA p36956-1 Sterol regulatory element-binding protein 1 SREBF1 BHLHD1 SREBP1 Class D basic helix-loop-helix protein 1 Sterol regulatory element-binding transcription factor 1 protein protein human Homo sapiens Human MDEPPFSEAALEQALGEPCDLDAALLTDIEDMLQLINNQDSDFPGLFDPPYAGSGAGGTDPASPDTSSPGSLSPPPATLSSSLEAFLSGPQAAPSPLSPPQPAPTPLKMYPSMPAFSPGPGIKEESVPLSILQTPTPQPLPGALLPQSFPAPAPPQFSSTPVLGYPSPPGGFSTGSPPGNTQQPLPGLPLASPPGVPPVSLHTQVQSVVPQQLLTVTAAPTAAPVTTTVTSQIQQVPVLLQPHFIKADSLLLTAMKTDGATVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDAEKLPINRLAAGSKAPASAQSRGEKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRTAVHKSKSLKDLVSACGSGGNTDVLMEGVKTEVEDTLTPPPSDAGSPFQSSPLSLGSRGSGSGGSGSDSEPDSPVFEDSKAKPEQRPSLHSRGMLDRSRLALCTLVFLCLSCNPLASLLGARGLPSPSDTTSVYHSPGRNVLGTESRDGPGWAQWLLPPVVWLLNGLLVLVSLVLLFVYGEPVTRPHSGPAVYFWRHRKQADLDLARGDFAQAAQQLWLALRALGRPLPTSHLDLACSLLWNLIRHLLQRLWVGRWLAGRAGGLQQDCALRVDASASARDAALVYHKLHQLHTMGKHTGGHLTATNLALSALNLAECAGDAVSVATLAEIYVAAALRVKTSLPRALHFLTRFFLSSARQACLAQSGSVPPAMQWLCHPVGHRFFVDGDWSVLSTPWESLYSLAGNPVDPLAQVTQLFREHLLERALNCVTQPNPSPGSADGDKEFSDALGYLQLLNSCSDAAGAPAYSFSISSSMATTTGVDPVAKWWASLTAVVIHWLRRDEEAAERLCPLVEHLPRVLQESERPLPRAALHSFKAARALLGCAKAESGPASLTICEKASGYLQDSLATTPASSSIDKAVQLFLCDLLLVVRTSLWRQQQPPAPAPAAQGTSSRPQASALELRGFQRDLSSLRRLAQSFRPAMRRVFLHEATARLMAGASPTRTHQLLDRSLRRRAGPGGKGGAVAELEPRPTRREHAEALLLASCYLPPGFLSAPGQRVGMLAEAARTLEKLGDRRLLHDCQQMLMRLGGGTTVTSS cbp_human CREB-binding protein CREBBP CBP Histone lysine acetyltransferase CREBBP Protein-lysine acetyltransferase CREBBP protein protein human Homo sapiens Human MAENLLDGPPNPKRAKLSSPGFSANDSTDFGSLFDLENDLPDELIPNGGELGLLNSGNLVPDAASKHKQLSELLRGGSGSSINPGIGNVSASSPVQQGLGGQAQGQPNSANMASLSAMGKSPLSQGDSSAPSLPKQAASTSGPTPAASQALNPQAQKQVGLATSSPATSQTGPGICMNANFNQTHPGLLNSNSGHSLINQASQGQAQVMNGSLGAAGRGRGAGMPYPTPAMQGASSSVLAETLTQVSPQMTGHAGLNTAQAGGMAKMGITGNTSPFGQPFSQAGGQPMGATGVNPQLASKQSMVNSLPTFPTDIKNTSVTNVPNMSQMQTSVGIVPTQAIATGPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKNCTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGTGQQNATSLSNPNPIDPSSMQRAYAALGLPYMNQPQTQLQPQVPGQQPAQPQTHQQMRTLNPLGNNPMNIPAGGITTDQQPPNLISESALPTSLGATNPLMNDGSNSGNIGTLSTIPTAAPPSSTGVRKGWHEHVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYKIQKELEEKRRSRLHKQGILGNQPALPAPGAQPPVIPQAQPVRPPNGPLSLPVNRMQVSQGMNSFNPMSLGNVQLPQAPMGPRAASPMNHSVQMNSMGSVPGMAISPSRMPQPPNMMGAHTNNMMAQAPAQSQFLPQNQFPSSSGAMSVGMGQPPAQTGVSQGQVPGAALPNPLNMLGPQASQLPCPPVTQSPLHPTPPPASTAAGMPSLQHTTPPGMTPPQPAAPTQPSTPVSSSGQTPTPTPGSVPSATQTQSTPTVQAAAQAQVTPQPQTPVQPPSVATPQSSQQQPTPVHAQPPGTPLSQAAASIDNRVPTPSSVASAETNSQQPGPDVPVLEMKTETQAEDTEPDPGESKGEPRSEMMEEDLQGASQVKEETDIAEQKSEPMEVDEKKPEVKVEVKEEEESSSNGTASQSTSPSQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRPRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKKEESTAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDLSQKLYATMEKHKEVFFVIHLHAGPVINTLPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHAHKMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQHRLQQAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPAQPQPSPVSMSPAGFPSVARTQPPTTVSTGKPTSQVPAPPPPAQPPPAAVEAARQIEREAQQQQHLYRVNINNSMPPGRTGMGTPGSQMAPVSLNVPRPNQVSGPVMPSMPPGQWQQAPLPQQQPMPGLPRPVISMQAQAAVAGPRMPSVQPPRSISPSALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAAFIKQRTAKYVANQPGMQPQPGLQSQPGMQPQPGMHQQPSLQNLNAMQAGVPRPGVPPQQQAMGGLNPQGQALNIMNPGHNPNMASMNPQYREMLRRQLLQQQQQQQQQQQQQQQQQQGSAGMAGGMAGHGQFQQPQGPGGYPPAMQQQQRMQQHLPLQGSSMGQMAAQMGQLGQMGQPGLGADSTPNIQQALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSGQPQASHLPGQQIATSLSNQVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSIDQGHLGNPEQSAMLPQLNTPSRSALSSELSLVGDTTGDTLEKFVEGL p36956-3 Sterol regulatory element-binding protein 1 SREBF1 BHLHD1 SREBP1 Class D basic helix-loop-helix protein 1 Sterol regulatory element-binding transcription factor 1 protein protein human Homo sapiens Human MDCTFEDMLQLINNQDSDFPGLFDPPYAGSGAGGTDPASPDTSSPGSLSPPPATLSSSLEAFLSGPQAAPSPLSPPQPAPTPLKMYPSMPAFSPGPGIKEESVPLSILQTPTPQPLPGALLPQSFPAPAPPQFSSTPVLGYPSPPGGFSTGSPPGNTQQPLPGLPLASPPGVPPVSLHTQVQSVVPQQLLTVTAAPTAAPVTTTVTSQIQQVPVLLQPHFIKADSLLLTAMKTDGATVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDAEKLPINRLAAGSKAPASAQSRGEKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRTAVHKSKSLKDLVSACGSGGNTDVLMEGVKTEVEDTLTPPPSDAGSPFQSSPLSLGSRGSGSGGSGSDSEPDSPVFEDSKAKPEQRPSLHSRGMLDRSRLALCTLVFLCLSCNPLASLLGARGLPSPSDTTSVYHSPGRNVLGTESRDGPGWAQWLLPPVVWLLNGLLVLVSLVLLFVYGEPVTRPHSGPAVYFWRHRKQADLDLARGDFAQAAQQLWLALRALGRPLPTSHLDLACSLLWNLIRHLLQRLWVGRWLAGRAGGLQQDCALRVDASASARDAALVYHKLHQLHTMGKHTGGHLTATNLALSALNLAECAGDAVSVATLAEIYVAAALRVKTSLPRALHFLTRFFLSSARQACLAQSGSVPPAMQWLCHPVGHRFFVDGDWSVLSTPWESLYSLAGNPVDPLAQVTQLFREHLLERALNCVTQPNPSPGSADGDKEFSDALGYLQLLNSCSDAAGAPAYSFSISSSMATTTGVDPVAKWWASLTAVVIHWLRRDEEAAERLCPLVEHLPRVLQESERPLPRAALHSFKAARALLGCAKAESGPASLTICEKASGYLQDSLATTPASSSIDKAVQLFLCDLLLVVRTSLWRQQQPPAPAPAAQGTSSRPQASALELRGFQRDLSSLRRLAQSFRPAMRRLMDVLTSESAWALPQHLGKGFPSPSGHKVPGWHGRMD Predominantly expressed in liver and adipose tissues. q9xx00_caeel sbp-1 CELE_Y47D3B.7 Y47D3B.7 protein protein caeel Caenorhabditis elegans MNEEFEGDVPMSDPFLSLVTKLDDIAPFPNNDPLDFDMEHNWQEPGPSQQPDPSIPGNQHSPPQEYYDIDGQRDVSTLHSLLNHNNDDFFSMRFSPPNFDLGGGRGPSLAATQQLSGEGPASMLNPLQTSPPSGGYPPADAYRPLSLAQQLAAPAMTPHQAASLFVNTNGIDQKNFTHAMLSPPHHTSMTPQPYTEAMEHINGYMSPYDQAQGPSGPSYYSQHHQSPPPHHHHHHPMPKIHENPEQVASPSIEDAPETKPTHLVEPQSPKSPQNMKEELLRLLVNMSPSEVERLKNKKSGACSATNGPSRSKEKAAKIVIQETAEGDEDEDDEDSDSGETMSQGTTIIVRRPKTERRTAHNLIEKKYRCSINDRIQQLKVLLCGDEAKLSKSATLRRAIEHIEEVEHENQVLKHHVEQMRKTLQNNRLPYPEPIQYTEYSARSPVESSPSPPRNERKRSRMSTTTPMKNGTRDGSSKVTLFAMLLAVLIFNPIGLLAGSAIFSKAAAEAPIASPFEHGRVIDDPDGTSTRTLFWEGSIINMSYVWVFNILMIIYVVVKLLIHGDPVQDFMSVSWQTFVTTREKARAELNSGNLKDAQRKFCECLATLDRSLPSPGVDSVFSVGWECVRHLLNWLWIGRYIARRRRSTTKPVSVVCRSHAQTAVLYHEIHQLHLMGITGNFEDTYEPSALTGLFMSLCAVNLAEAAGASNDGLPRAVMAQIYISASIQCRLALPNLLAPFFSGYFLRRARRHVRRAPEHSVSHLLWIFHPATRKFMSDAKRLEHVLSSKQKQLRFGSFVEDEQLSPLARIRTTLKVYLLSKLVQELVGGDEIFTKNVERILNDNDRLDDEVDVVDVSRLLVTISTQCAAILTNEKDESAKFGTWISRNGDACCTWWTHVLTCGIYWRSNKNELARQHYSLIRNCPPKILTDNLGLAVGHALCARKICIDDRDSPKVSQYVCIHTKKSLESLRLFSTSSRASGVVSGIQEGTRRMAYEWIMNSLLDAWRSNLFASKPYWTQSFKGQSTFSTLYQEAYNHYAIINGTRGDCWRLFVYELTCRMLNGANPQATWSGVRRVRSTKMDAVRGRVSMRRSAQPDAFHLHTLVKLHTSMDL srbp2_human Sterol regulatory element-binding protein 2 SREBF2 SREBP2 Sterol regulatory element-binding transcription factor 2 BHLHD2 Class D basic helix-loop-helix protein 2 protein protein human Homo sapiens Human MDDSGELGGLETMETLTELGDELTLGDIDEMLQFVSNQVGEFPDLFSEQLCSSFPGSGGSGSSSGSSGSSSSSSNGRGSSSGAVDPSVQRSFTQVTLPSFSPSAASPQAPTLQVKVSPTSVPTTPRATPILQPRPQPQPQPQTQLQQQTVMITPTFSTTPQTRIIQQPLIYQNAATSFQVLQPQVQSLVTSSQVQPVTIQQQVQTVQAQRVLTQTANGTLQTLAPATVQTVAAPQVQQVPVLVQPQIIKTDSLVLTTLKTDGSPVMAAVQNPALTALTTPIQTAALQVPTLVGSSGTILTTMPVMMGQEKVPIKQVPGGVKQLEPPKEGERRTTHNIIEKRYRSSINDKIIELKDLVMGTDAKMHKSGVLRKAIDYIKYLQQVNHKLRQENMVLKLANQKNKLLKGIDLGSLVDNEVDLKIEDFNQNVLLMSPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDRSRILLCVLTFLCLSFNPLTSLLQWGGAHDSDQHPHSGSGRSVLSFESGSGGWFDWMMPTLLLWLVNGVIVLSVFVKLLVHGEPVIRPHSRSSVTFWRHRKQADLDLARGDFAAAAGNLQTCLAVLGRALPTSRLDLACSLSWNVIRYSLQKLRLVRWLLKKVFQCRRATPATEAGFEDEAKTSARDAALAYHRLHQLHITGKLPAGSACSDVHMALCAVNLAECAEEKIPPSTLVEIHLTAAMGLKTRCGGKLGFLASYFLSRAQSLCGPEHSAVPDSLRWLCHPLGQKFFMERSWSVKSAAKESLYCAQRNPADPIAQVHQAFCKNLLERAIESLVKPQAKKKAGDQEEESCEFSSALEYLKLLHSFVDSVGVMSPPLSRSSVLKSALGPDIICRWWTSAITVAISWLQGDDAAVRSHFTKVERIPKALEVTESPLVKAIFHACRAMHASLPGKADGQQSSFCHCERASGHLWSSLNVSGATSDPALNHVVQLLTCDLLLSLRTALWQKQASASQAVGETYHASGAELAGFQRDLGSLRRLAHSFRPAYRKVFLHEATVRLMAGASPTRTHQLLEHSLRRRTTQSTKHGEVDAWPGQRERATAILLACRHLPLSFLSSPGQRAVLLAEAARTLEKVGDRRSCNDCQQMIVKLGGGTAIAAS med1_human Mediator of RNA polymerase II transcription subunit 1 TRIP2 MED1 ARC205 DRIP205 TRAP220 Activator-recruited cofactor 205 kDa component Mediator complex subunit 1 Peroxisome proliferator-activated receptor-binding protein Thyroid hormone receptor-associated protein complex 220 kDa component Thyroid receptor-interacting protein 2 p53 regulatory protein RB18A Vitamin D receptor-interacting protein complex component DRIP205 CRSP1 CRSP200 DRIP230 PBP PPARBP PPARGBP RB18A protein protein human Homo sapiens Human MKAQGETEESEKLSKMSSLLERLHAKFNQNRPWSETIKLVRQVMEKRVVMSSGGHQHLVSCLETLQKALKVTSLPAMTDRLESIARQNGLGSHLSASGTECYITSDMFYVEVQLDPAGQLCDVKVAHHGENPVSCPELVQQLREKNFDEFSKHLKGLVNLYNLPGDNKLKTKMYLALQSLEQDLSKMAIMYWKATNAGPLDKILHGSVGYLTPRSGGHLMNLKYYVSPSDLLDDKTASPIILHENNVSRSLGMNASVTIEGTSAVYKLPIAPLIMGSHPVDNKWTPSFSSITSANSVDLPACFFLKFPQPIPVSRAFVQKLQNCTGIPLFETQPTYAPLYELITQFELSKDPDPIPLNHNMRFYAALPGQQHCYFLNKDAPLPDGRSLQGTLVSKITFQHPGRVPLILNLIRHQVAYNTLIGSCVKRTILKEDSPGLLQFEVCPLSESRFSVSFQHPVNDSLVCVVMDVQDSTHVSCKLYKGLSDALICTDDFIAKVVQRCMSIPVTMRAIRRKAETIQADTPALSLIAETVEDMVKKNLPPASSPGYGMTTGNNPMSGTTTPTNTFPGGPITTLFNMSMSIKDRHESVGHGEDFSKVSQNPILTSLLQITGNGGSTIGSSPTPPHHTPPPVSSMAGNTKNHPMLMNLLKDNPAQDFSTLYGSSPLERQNSSSGSPRMEICSGSNKTKKKKSSRLPPEKPKHQTEDDFQRELFSMDVDSQNPIFDVNMTADTLDTPHITPAPSQCSTPPTTYPQPVPHPQPSIQRMVRLSSSDSIGPDVTDILSDIAEEASKLPSTSDDCPAIGTPLRDSSSSGHSQSTLFDSDVFQTNNNENPYTDPADLIADAAGSPSSDSPTNHFFHDGVDFNPDLLNSQSQSGFGEEYFDESSQSGDNDDFKGFASQALNTLGVPMLGGDNGETKFKGNNQADTVDFSIISVAGKALAPADLMEHHSGSQGPLLTTGDLGKEKTQKRVKEGNGTSNSTLSGPGLDSKPGKRSRTPSNDGKSKDKPPKRKKADTEGKSPSHSSSNRPFTPPTSTGGSKSPGSAGRSQTPPGVATPPIPKITIQIPKGTVMVGKPSSHSQYTSSGSVSSSGSKSHHSHSSSSSSSASTSGKMKSSKSEGSSSSKLSSSMYSSQGSSGSSQSKNSSQSGGKPGSSPITKHGLSSGSSSTKMKPQGKPSSLMNPSLSKPNISPSHSRPPGGSDKLASPMKPVPGTPPSSKAKSPISSGSGGSHMSGTSSSSGMKSSSGLGSSGSLSQKTPPSSNSCTASSSSFSSSGSSMSSSQNQHGSSKGKSPSRNKKPSLTAVIDKLKHGVVTSGPGGEDPLDGQMGVSTNSSSHPMSSKHNMSGGEFQGKREKSDKDKSKVSTSGSSVDSSKKTSESKNVGSTGVAKIIISKHDGGSPSIKAKVTLQKPGESSGEGLRPQMASSKNYGSPLISGSTPKHERGSPSHSKSPAYTPQNLDSESESGSSIAEKSYQNSPSSDDGIRPLPEYSTEKHKKHKKEKKKVKDKDRDRDRDKDRDKKKSHSIKPESWSKSPISSDQSLSMTSNTILSADRPSRLSPDFMIGEEDDDLMDVALIGN med6_human Mediator of RNA polymerase II transcription subunit 6 ARC33 MED6 Mediator complex subunit 6 Activator-recruited cofactor 33 kDa component Renal carcinoma antigen NY-REN-28 protein protein human Homo sapiens Human MAAVDIRDNLLGISWVDSSWIPILNSGSVLDYFSERSNPFYDRTCNNEVVKMQRLTLEHLNQMVGIEYILLHAQEPILFIIRKQQRQSPAQVIPLADYYIIAGVIYQAPDLGSVINSRVLTAVHGIQSAFDEAMSYCRYHPSKGYWWHFKDHEEQDKVRPKAKRKEEPSSIFQRQRVDALLLDLRQKFPPKFVQLKPGEKPVPVDQTKKEAEPIPETVKPEEKETTKNVQQTVSAKGPPEKRMRLQ cdk8_human Cyclin-dependent kinase 8 CDK8 Cell division protein kinase 8 Mediator of RNA polymerase II transcription subunit CDK8 Mediator complex subunit CDK8 Protein kinase K35 protein protein human Homo sapiens Human MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYALKQIEGTGISMSACREIALLRELKHPNVISLQKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKPVQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPADKDWEDIKKMPEHSTLMKDFRRNTYTNCSLIKYMEKHKVKPDSKAFHLLQKLLTMDPIKRITSEQAMQDPYFLEDPLPTSDVFAGCQIPYPKREFLTEEEPDDKGDKKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY myb_human Transcriptional activator Myb MYB Proto-oncogene c-Myb protein protein human Homo sapiens Human MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPELIKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIVNVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPADPGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQKENTVFRTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEVESPTDKSGNFFCSHHWEGDSLNTQLFTQTSPVADAPNILTSSVLMAPASEDEDNVLKAFTVPKNRSLASPLQPCSSTWEPASCGKMEEQMTSSSQARKYVNAFSARTLVM creb1_human Cyclic AMP-responsive element-binding protein 1 CREB1 protein protein human Homo sapiens Human MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPNGQTVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQESVDSVTDSQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD med15_caeel Mediator of RNA polymerase II transcription subunit 15 R12B2.5 Mediator complex subunit 15 mdt-15 protein protein caeel Caenorhabditis elegans MSEEDWPSPKFREHVIQRLEPELARNRQNAPNLPVPGDARQVEEYVFAKCMSKDEYMRTIAKVINAINCNSKSAAVPSVLQPSQFHSPPCTTAALLGNTPAGGTPGYRAPVPPDPQPTSAQARNPPVTVATTQASTTPSAPNPPGGLPAPSASATAAVAAAVASFPSPDTSIRPGGQITPGSQAPGGGPTPAPNVPFPNGSSQMNGGPAMGQPPPQMGAPNMGGPPNGYGGYGMMNGPPGSGAPMGGNPYNQQIKKDMDQARPWDPSAHMYQQQPQWGAMPPQQPHGYPGRPMNGQGATPTGPSSVLESLINQPQQYPGHHNQMGPPGDRNVAAQRAAAQQQQQQQQQQQQQRPGMVPNQGMMSSEDQTVYSAKLRNMRGSCDSLRTRARQCRHEGNHEAAHKLEVMLSVLEGKRVVSLEYLNHLEMWIARKQDFLNIAPMSQNQNHMGMNDPMMNGEHAMLGNGQVPNPYGGHPGYGHQQYMGPPPPHMQMHQPPMWHQQQHQQQQRMMPQDHMMMQGGGGPVHGMYRGDMGHDPMTSPVNNHRHAPYPNPAAMRNNMRMPNGPGPIGRDRNSMSGSSMSGPSSGAPSMNPMGTPNQKMGTPGSMGGMSGLDDLNYDDFLPNPTPIDALQPTLHVGQNSMNAGPPVQRSNLNETARKELQILDARFEIDPNHQRHDANHIIVVCKIRNQQFPPLRLVVPTTYPAGNVTVDRAVIDLDAYLYDDLQNSVYERLSRPGLSSITDYLNAWEEQVNQYQNQTSGGLDVAFNVGNDFFYDNLNL srebf1-med15-1 3145282 N/A 3145300 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 3145301 unspecified role unspecified role bait bait Region 1-50 Region 1-50 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false srebf1-crebbp-1 3145283 N/A 3145302 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3145301 unspecified role unspecified role bait bait Region 21-50 Region 21-50 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false srebf1-med15-2 3145284 N/A 3145303 unspecified role unspecified role bait bait Region 1-26 Region 1-26 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3145300 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false med15-sbp_1-1 3145285 N/A 3145300 unspecified role unspecified role bait bait Region 1-96 Region 1-96 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3145304 unspecified role unspecified role prey prey Region 1-100 Region 1-100 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false srebf2-med15-1 3145286 N/A 3145305 unspecified role unspecified role bait bait Region 1-49 Region 1-49 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3145300 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false srebf1-med15-3 3145287 N/A 3145300 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3145301 unspecified role unspecified role bait bait Region 21-50 Region 21-50 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli physical association physical association false false false srebf1-med15-4 3145288 N/A 3145300 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3145301 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Region 1-487 Region 1-487 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false crebbp-srebf1-1 3145289 N/A 3145301 unspecified role unspecified role prey prey Region 1-487 Region 1-487 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3145302 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 591-668 Region 591-668 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false srebf1-crebbp-2 3145290 N/A 3145303 unspecified role unspecified role bait bait Region 1-26 Region 1-26 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3145302 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false med15-srebf1-1 3145291 N/A 3145300 unspecified role unspecified role unspecified role unspecified role Region 9-73 Region 9-73 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3145301 unspecified role unspecified role unspecified role unspecified role Region 17-42 Region 17-42 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false FITC-label FITC-label fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false srebf2-crebbp-1 3145292 N/A 3145305 unspecified role unspecified role bait bait Region 1-49 Region 1-49 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3145302 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm physical association physical association false false false srebf1-cdk8-1 3145293 N/A 3145303 unspecified role unspecified role bait bait Region 1-26 Region 1-26 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3145306 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3145307 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3145302 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3145300 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3145308 unspecified role unspecified role prey prey human Homo sapiens Human association association false false false med15-srebf1-2 3145294 N/A 3145300 unspecified role unspecified role bait bait Q96RN5:p.Glu42Ala E42A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q96RN5:p.Leu58Asp L58D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q96RN5:p.Ala60Asp A60D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3145301 unspecified role unspecified role prey prey Region 1-487 Region 1-487 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm direct interaction direct interaction false false false crebbp-myb-1 3145295 N/A 3145309 unspecified role unspecified role prey prey Region 270-325 Region 270-325 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3145302 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 591-668 Region 591-668 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false crebbp-creb1-1 3145296 N/A 3145310 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3145302 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Region 591-668 Region 591-668 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false mdt_15-sbp_1-1 3145297 N/A 3145304 unspecified role unspecified role prey prey Region 1-100 Region 1-100 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3145311 unspecified role unspecified role bait bait Region 2-96 Region 2-96 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false srebf2-cdk8-1 3145298 N/A 3145305 unspecified role unspecified role bait bait Region 1-49 Region 1-49 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3145306 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3145307 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3145302 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3145300 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3145308 unspecified role unspecified role prey prey human Homo sapiens Human association association false false false srebf1-cdk8-2 3145299 N/A 3145306 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3145307 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3145302 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3145300 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3145308 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3145301 unspecified role unspecified role bait bait Region 21-50 Region 21-50 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli association association false false false