DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ rousseau-2006-1 chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Rousseau F., Gauchat JF., McLeod JG., Chevalier S., Guillet C., Guilhot F., Cognet I., Froger J., Hahn AF., Knappskog PM., Gascan H., Boman H. DIP original experiment: DIP-263219X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Inactivation of cardiotrophin-like cytokine, a second ligand for ciliary neurotrophic factor receptor, leads to cold-induced sweating syndrome in a patient. Rousseau F., Gauchat JF., McLeod JG., Chevalier S., Guillet C., Guilhot F., Cognet I., Froger J., Hahn AF., Knappskog PM., Gascan H., Boman H. Only protein-protein interactions imex curation crlf1_human Cytokine receptor-like factor 1 CRLF1 Cytokine-like factor 1 ZcytoR5 UNQ288/PRO327 protein protein human Homo sapiens Human MPAGRRGPAAQSARRPPPLLPLLLLLCVLGAPRAGSGAHTAVISPQDPTLLIGSSLLATCSVHGDPPGATAEGLYWTLNGRRLPPELSRVLNASTLALALANLNGSRQRSGDNLVCHARDGSILAGSCLYVGLPPEKPVNISCWSKNMKDLTCRWTPGAHGETFLHTNYSLKYKLRWYGQDNTCEEYHTVGPHSCHIPKDLALFTPYEIWVEATNRLGSARSDVLTLDILDVVTTDPPPDVHVSRVGGLEDQLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVSNQTSCRLAGLKPGTVYFVQVRCNPFGIYGSKKAGIWSEWSHPTAASTPRSERPGPGGGACEPRGGEPSSGPVRRELKQFLGWLKKHAYCSNLSFRLYDQWRAWMQKSHKTRNQDEGILPSGRRGTARGPAR clcf1_human Cardiotrophin-like cytokine factor 1 CLCF1 BSF3 CLC NNT1 B-cell-stimulating factor 3 Novel neurotrophin-1 protein protein human Homo sapiens Human MDLRAGDSWGMLACLCTVLWHLPAVPALNRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYEAYSHLLCYLRGLNRQAATAELRRSLAHFCTSLQGLLGSIAGVMAALGYPLPQPLPGTEPTWTPGPAHSDFLQKMDDFWLLKELQTWLWRSAKDFNRLKKKMQPPAAAVTLHLGAHGF crlf1-clcf1-1 3145001 N/A 3145002 unspecified role unspecified role bait bait chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey N/A 3145003 unspecified role unspecified role prey prey ProtC-tag ProtC-tag fusion protein fusion protein n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association false false false