DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dodsworth-2006-1 metmi Methanococcus maripaludis Methanococcus deltae pull down pull down ms participant Identification by mass spectrometry ms participant Dodsworth JA., Leigh JA. DIP original experiment: DIP-263208X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Regulation of nitrogenase by 2-oxoglutarate-reversible, direct binding of a PII-like nitrogen sensor protein to dinitrogenase. Dodsworth JA., Leigh JA. Only protein-protein interactions imex curation dodsworth-2006-2 metmi Methanococcus maripaludis Methanococcus deltae molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Dodsworth JA., Leigh JA. DIP original experiment: DIP-263212X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Regulation of nitrogenase by 2-oxoglutarate-reversible, direct binding of a PII-like nitrogen sensor protein to dinitrogenase. Dodsworth JA., Leigh JA. Only protein-protein interactions imex curation dodsworth-2006-3 metmi Methanococcus maripaludis Methanococcus deltae molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Dodsworth JA., Leigh JA. DIP original experiment: DIP-263210X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Regulation of nitrogenase by 2-oxoglutarate-reversible, direct binding of a PII-like nitrogen sensor protein to dinitrogenase. Dodsworth JA., Leigh JA. Only protein-protein interactions imex curation dodsworth-2006-4 metmi Methanococcus maripaludis Methanococcus deltae pull down pull down ms participant Identification by mass spectrometry ms participant Dodsworth JA., Leigh JA. DIP original experiment: DIP-263209X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Regulation of nitrogenase by 2-oxoglutarate-reversible, direct binding of a PII-like nitrogen sensor protein to dinitrogenase. Dodsworth JA., Leigh JA. Only protein-protein interactions imex curation dodsworth-2006-5 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Dodsworth JA., Leigh JA. DIP original experiment: DIP-263211X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Regulation of nitrogenase by 2-oxoglutarate-reversible, direct binding of a PII-like nitrogen sensor protein to dinitrogenase. Dodsworth JA., Leigh JA. Only protein-protein interactions imex curation nifk_metmi Nitrogenase molybdenum-iron protein beta chain nifK Dinitrogenase Nitrogenase component I protein protein metmi Methanococcus maripaludis Methanococcus deltae MSELNVITKERTAVINPIVTCQPLGAMYAVSGIERGMPLVHGSQGCSTFVRYGFARHFREPADIAVTSLHEDAAVFGGRKNLISGLGNLAARFKPDVMGVVTTCSSEIIGDDVAGFIKTAKVEIAKKMGEEAANKIKIVQINTPSFVEHQFKGYDNAIKAIVDTLAEPKDEENGKLIIIPGIVNPGDIREIKHMLSLMGVEGILLTDTSDPFDSPLRPSKADKNPYYQKGGTPLADLQDCANSLGTISLANYANSAPASLEKKYNMPSKVSEAPIGIQNTDSFIRTVKKFTGNDVTDEILDERGIVIDAMADVASRYLFGRKVAIYGDPSITVGMARFVAELGMIPKVVCTGVKNEYFVNDLKKVAKESDEDIDALFGQDLRALDVYLKENPVDLMIGSSDGRLMAKDLGIPLYRVGYPVYDRVGYQRRPIIGYNGALNLVDGITNTILDKYYETQDWKLQQ nifd_metmi Nitrogenase molybdenum-iron protein alpha chain nifD Dinitrogenase Nitrogenase component I protein protein metmi Methanococcus maripaludis Methanococcus deltae MPFCLLDVDKDIPEREQHIYIKDSKEPKGHCKQRCNTNTIPGSMTERGCAFAGVKGVITGAIKDVLHVVHSPVGCTAYGNGTTKRYPTRPEMPDGSVFPVENFNLKHIVGTDLTESDVVFGGMNKLKKVIREASKEFPFVNAIYVYATCTTGLIGDDLDAVCKEMQAELGKDVVAFNAPGFAGPTQSKGHHVGNYTIFENLVGTKEPPKTTDYDINLIGEYNIDGDYWVLEKYFEDMGINVLSKFTGDATHGELCWMHKAKLSLVRCQRSATYVAKLIEEKYGVPYLKVDFFGPEYCAENLRAVGKYFGKEIEAEAVIQKEMEKIQPELDFYQSKLQGKKIWISAGGPKSWHLSKPIEQYLGMDVVALSGLFEHEDGYEKMQERAKDGTIIIDDPNTLEMEEVVEKYQPEIVLGGIKEKYFFHKLGVPSVMIHSYENGPYIGFGGFVNMARDIFTAIYNPAWKLMGFGEGEPGDSNE glnb2_metmi Nitrogen fixation nifHD region glnB-like protein 2 glnBII nifI2 protein protein metmi Methanococcus maripaludis Methanococcus deltae MKEIIAIIRPSKMAQTKTVLEGLGFPAMTANRVLGRGKQKAIVGELGFEVDNKELLNQPGDMRYIPKTMLTLIVPDEDASLVVEAIMKVNKSGQYGDGKIFVCPIEDIITVRTSERGEAAI glnb1_metmi Nitrogen fixation nifHD region glnB-like protein 1 glnBI nifI1 protein protein metmi Methanococcus maripaludis Methanococcus deltae MKMIRAVVRPSKAEEVVDALAESGCLALTKMDVIGRGKQKGIKIDQIYYDELPKTMLMLVVEDDTAENVIELITKTAYTGSFGYGKIFVSPVDEAYTVRTRSCGL glnbi-glnbii-1 3144933 N/A 3144938 unspecified role unspecified role prey prey metmi Methanococcus maripaludis Methanococcus deltae N/A 3144939 unspecified role unspecified role prey prey metmi Methanococcus maripaludis Methanococcus deltae N/A 3144940 unspecified role unspecified role prey prey metmi Methanococcus maripaludis Methanococcus deltae N/A 3144941 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false metmi Methanococcus maripaludis Methanococcus deltae association association false false false nifd-nifk-1 3144934 N/A 3144938 unspecified role unspecified role unspecified role unspecified role metmi Methanococcus maripaludis Methanococcus deltae N/A 3144939 unspecified role unspecified role unspecified role unspecified role metmi Methanococcus maripaludis Methanococcus deltae direct interaction direct interaction false false false glnbi-glnbii-2 3144935 N/A 3144940 unspecified role unspecified role unspecified role unspecified role metmi Methanococcus maripaludis Methanococcus deltae N/A 3144941 unspecified role unspecified role unspecified role unspecified role metmi Methanococcus maripaludis Methanococcus deltae direct interaction direct interaction false false false glnbii-glnbi-1 3144936 N/A 3144938 unspecified role unspecified role prey prey metmi Methanococcus maripaludis Methanococcus deltae N/A 3144939 unspecified role unspecified role prey prey metmi Methanococcus maripaludis Methanococcus deltae N/A 3144940 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false metmi Methanococcus maripaludis Methanococcus deltae N/A 3144941 unspecified role unspecified role prey prey metmi Methanococcus maripaludis Methanococcus deltae association association false false false glnbi-glnbii-3 3144937 N/A 3144938 unspecified role unspecified role unspecified role unspecified role metmi Methanococcus maripaludis Methanococcus deltae N/A 3144939 unspecified role unspecified role unspecified role unspecified role metmi Methanococcus maripaludis Methanococcus deltae N/A 3144940 unspecified role unspecified role unspecified role unspecified role metmi Methanococcus maripaludis Methanococcus deltae N/A 3144941 unspecified role unspecified role unspecified role unspecified role metmi Methanococcus maripaludis Methanococcus deltae physical association physical association false false false