DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ onken-2006-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Onken B., Wiener H., Philips MR., Chang EC. DIP original experiment: DIP-263174X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Compartmentalized signaling of Ras in fission yeast. Onken B., Wiener H., Philips MR., Chang EC. Only protein-protein interactions imex curation onken-2006-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Onken B., Wiener H., Philips MR., Chang EC. DIP original experiment: DIP-263175X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Compartmentalized signaling of Ras in fission yeast. Onken B., Wiener H., Philips MR., Chang EC. Only protein-protein interactions imex curation onken-2006-3 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Onken B., Wiener H., Philips MR., Chang EC. DIP original experiment: DIP-263176X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Compartmentalized signaling of Ras in fission yeast. Onken B., Wiener H., Philips MR., Chang EC. Only protein-protein interactions imex curation scd1_schpo Rho guanine nucleotide exchange factor scd1 scd1 ral1 SPAC16E8.09 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MAYFQDRKTSSRSLPSYINHSTQNLVGPRKDETNLSEYMKLRLLQSPSQVIYNLENTVSLYRRCLNLRKRLMDISELAAFFDSIHREALNSSFKILEFKDIEFDDPVTEIWLFCRLGYPLCALFNCLPVKQKLEVNSSVSLENTNVCKASLYRFMLMCKNELGLTDAALFSISEIYKPSTAPLVRALQTIELLLKKYEVSNTTKSSSTPSPSTDDNVPTGTLNSLIASGRRVTAELYETELKYIQDLEYLSNYMVILQQKQILSQDTILSIFTNLNEILDFQRRFLVGLEMNLSLPVEEQRLGALFIALEEGFSVYQVFCTNFPNAQQLIIDNQNQLLKVANLLEPSYELPALLIKPIQRICKYPLLLNQLLKGTPSGYQYEEELKQGMACVVRVANQVNETRRIHENRNAIIELEQRVIDWKGYSLQYFGQLLVWDVVNVCKADIEREYHVYLFEKILLCCKEMSTLKRQARSISMNKKTKRLDSLQLKGRILTSNITTVVPNHHMGSYAIQIFWRGDPQHESFILKLRNEESHKLWMSVLNRLLWKNEHGSPKDIRSAASTPANPVYNRSSSQTSKGYNSSDYDLLRTHSLDENVNSPTSISSPSSKSSPFTKTTSKDTKSATTTDERPSDFIRLNSEESVGTSSLRTSQTTSTIVSNDSSSTASIPSQISRISQVNSLLNDYNYNRQSHITRVYSGTDDGSSVSIFEDTSSSTKQKIFDQPTTNDCDVMRPRQYSYSAGMKSDGSLLPSTKHTSLSSSSTSTSLSVRNTTNVKIRLRLHEVSLVLVVAHDITFDELLAKVEHKIKLCGILKQAVPFRVRLKYVDEDGDFITITSDEDVLMAFETCTFELMDPVHNKGMDTVSLHVVVYF 726FAE33B519D69D ras_schpo Ras-like protein 1 ras1 SPAC17H9.09c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MRSTYLREYKLVVVGDGGVGKSALTIQLIQSHFVDEYDPTIEDSYRKKCEIDGEGALLDVLDTAGQEEYSAMREQYMRTGEGFLLVYNITSRSSFDEISTFYQQILRVKDKDTFPVVLVANKCDLEAERVVSRAEGEQLAKSMHCLYVETSAKLRLNVEEAFYSLVRTIRRYNKSEEKGFQNKQAVQTAQVPASTAKRASAVNNSKTEDEVSTKCCVIC 109A0C468663F535 byr2_schpo Protein kinase byr2 byr2 ste8 SPBC1D7.05 SPBC2F12.01 Protein kinase ste8 MAPK kinase kinase protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MEYYTSKEVAEWLKSIGLEKYIEQFSQNNIEGRHLNHLTLPLLKDLGIENTAKGKQFLKQRDYLREFPRPCILRFIACNGQTRAVQSRGDYQKTLAIALKKFSLEDASKFIVCVSQSSRIKLITEEEFKQICFNSSSPERDRLIIVPKEKPCPSFEDLRRSWEIELAQPAALSSQSSLSPKLSSVLPTSTQKRSVRSNNAKPFESYQRPPSELINSRISDFFPDHQPKLLEKTISNSLRRNLSIRTSQGHNLGNFGQEILPRSSRRARPSELVCPLSSLRISVAEDVNRLPRIDRGFDPPLTVSSTQRISRPPSLQKSITMVGVEPLYQSNGNEKSSKYNVFSESAHGNHQVLSFSPGSSPSFIEQPSPISPTSTTSEDTNTLEEDTDDQSIKWIRGALIGSGSFGQVYLGMNASSGELMAVKQVILDSVSESKDRHAKLLDALAGEIALLQELSHEHIVQYLGSNLNSDHLNIFLEYVPGGSVAGLLTMYGSFEETLVKNFIKQTLKGLEYLHSRGIVHRDIKGANILVDNKGKIKISDFGISKKLELNSTSTKTGGARPSFQGSSFWMAPEVVKQTMHTEKTDIWSLGCLVIEMLTSKHPYPNCDQMQAIFRIGENILPEFPSNISSSAIDFLEKTFAIDCNLRPTASELLSHPFVS 18CD78F1D1FABBCD scd1-ras1-1 3144564 N/A 3144567 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3144568 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false byr2-ras1-1 3144565 N/A 3144569 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3144568 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false byr2-ras1-2 3144566 N/A 3144569 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3144568 unspecified role unspecified role prey prey T7-tag T7-tag t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false