DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ sonnenburg-2006-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Sonnenburg ED., Sonnenburg JL., Manchester JK., Hansen EE., Chiang HC., Gordon JI. DIP original experiment: DIP-263166X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A hybrid two-component system protein of a prominent human gut symbiont couples glycan sensing in vivo to carbohydrate metabolism. Sonnenburg ED., Sonnenburg JL., Manchester JK., Hansen EE., Chiang HC., Gordon JI. Only protein-protein interactions imex curation sonnenburg-2006-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Sonnenburg ED., Sonnenburg JL., Manchester JK., Hansen EE., Chiang HC., Gordon JI. DIP original experiment: DIP-263164X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A hybrid two-component system protein of a prominent human gut symbiont couples glycan sensing in vivo to carbohydrate metabolism. Sonnenburg ED., Sonnenburg JL., Manchester JK., Hansen EE., Chiang HC., Gordon JI. Only protein-protein interactions imex curation sonnenburg-2006-3 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Sonnenburg ED., Sonnenburg JL., Manchester JK., Hansen EE., Chiang HC., Gordon JI. DIP original experiment: DIP-263171X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A hybrid two-component system protein of a prominent human gut symbiont couples glycan sensing in vivo to carbohydrate metabolism. Sonnenburg ED., Sonnenburg JL., Manchester JK., Hansen EE., Chiang HC., Gordon JI. Only protein-protein interactions imex curation sonnenburg-2006-4 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Sonnenburg ED., Sonnenburg JL., Manchester JK., Hansen EE., Chiang HC., Gordon JI. DIP original experiment: DIP-263169X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A hybrid two-component system protein of a prominent human gut symbiont couples glycan sensing in vivo to carbohydrate metabolism. Sonnenburg ED., Sonnenburg JL., Manchester JK., Hansen EE., Chiang HC., Gordon JI. Only protein-protein interactions imex curation sonnenburg-2006-5 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Sonnenburg ED., Sonnenburg JL., Manchester JK., Hansen EE., Chiang HC., Gordon JI. DIP original experiment: DIP-263167X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A hybrid two-component system protein of a prominent human gut symbiont couples glycan sensing in vivo to carbohydrate metabolism. Sonnenburg ED., Sonnenburg JL., Manchester JK., Hansen EE., Chiang HC., Gordon JI. Only protein-protein interactions imex curation sonnenburg-2006-6 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Sonnenburg ED., Sonnenburg JL., Manchester JK., Hansen EE., Chiang HC., Gordon JI. DIP original experiment: DIP-263165X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A hybrid two-component system protein of a prominent human gut symbiont couples glycan sensing in vivo to carbohydrate metabolism. Sonnenburg ED., Sonnenburg JL., Manchester JK., Hansen EE., Chiang HC., Gordon JI. Only protein-protein interactions imex curation sonnenburg-2006-7 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Sonnenburg ED., Sonnenburg JL., Manchester JK., Hansen EE., Chiang HC., Gordon JI. DIP original experiment: DIP-263170X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A hybrid two-component system protein of a prominent human gut symbiont couples glycan sensing in vivo to carbohydrate metabolism. Sonnenburg ED., Sonnenburg JL., Manchester JK., Hansen EE., Chiang HC., Gordon JI. Only protein-protein interactions imex curation sonnenburg-2006-8 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Sonnenburg ED., Sonnenburg JL., Manchester JK., Hansen EE., Chiang HC., Gordon JI. DIP original experiment: DIP-263172X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A hybrid two-component system protein of a prominent human gut symbiont couples glycan sensing in vivo to carbohydrate metabolism. Sonnenburg ED., Sonnenburg JL., Manchester JK., Hansen EE., Chiang HC., Gordon JI. Only protein-protein interactions imex curation sonnenburg-2006-9 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Sonnenburg ED., Sonnenburg JL., Manchester JK., Hansen EE., Chiang HC., Gordon JI. DIP original experiment: DIP-263168X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A hybrid two-component system protein of a prominent human gut symbiont couples glycan sensing in vivo to carbohydrate metabolism. Sonnenburg ED., Sonnenburg JL., Manchester JK., Hansen EE., Chiang HC., Gordon JI. Only protein-protein interactions imex curation q8a2y3_bactn BT_3172 protein protein bactn Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) MKTRLLTLPGIIAIILLITTLPLRAEHYYYKQISLKEGLPSNVRCILRDEQGFIWIGTKAGLGKFDGHQLKRYKHQANDPHSLLHNLIYQIAEDKQHNIWILTEKGIARYQQQSNNFTFPTDEEGNYITAYSFCLVPDGILFGGKDRIYKYSYKDSSLRLLQYFNANSFKITALSVWDSKTLLCCSRWTGLYLVDLQTGEHRRPPFDCGPEITSMITDSKNRIWIAPYSGGLRCYSRDGKLSASYTTHNSSLSNDIVLSLAEREEQLWIGTDGGGINILHPETGEISQLEYIPGRENYSLPANSILCLHNDYNNNVWAGSTCNGLISIREVSMKTYTDVVPGNDRGLSNGTVRSLYRQSPDSIWIGTDGGGINLFSPHTEKFTHYSSTWGDKVAFISGFTPGKLLISLFSKGVFVFNPATGEKQPFTIIDKETTTRLCNRGKSVNLYQNTPNTVLFLGDHIYQYHLKEKKFSTITEEEGKDIVGTLVPFDHQENLTYINDIKHIYELDDQTSRLKTVFECYTDTVISSVSHDEQGHFWIGSNFGLIHYDPVLKSRTLVPTNLFTEINMVLCDQKGKVWIGVDNMLFAYFIKEQKFVLFGESNGAIQNEYLPNARLVNEQGDAYIGGVKGMLRIDGQLLLNTSEMPELQLLDITINGESANHEWYNHPAKISVPWNSNISIRIMSREEDIFRQKIYRYQIEGLNNEYTESYNPELVIRSLLPGSYRIMASCTAKDGSWIPDQQVLELTVLPPWYRTWWFSLTCAVLVSIAIIETFRRTVKRNEEKLKWAMKEHEKQTYEEKVRFLINISHELRTPLTLIHAPLNRILKSLSSEDPQYLPLKAIYRQAQRMKNLINMVLDVRKMEVGESKLLIQPHPLNHWIEHVSQDFISEGEAKNVRIRYQLDPQIETVSFDKDKCEIILSNLLINALKHSPQDTEITIASELLPETGRVRISIIDQGCGLKQVDTHKLFTRFYQGTGEQSGTGIGLSYSKILVEQHGGSIGAQDNPEAGAIFFFELPLKQESEEIICQPKAYLNELILSDNLKQATDKETFDTTPYTILVVDDNPDMTDFLKKTLEESFKRVIIAADGVEALQLIKSHIPDIIVSDVMMPRMNGYELCINIKEDITISHIPIILLTARDDKQSLISGYKNGADAYLTKPFEVEMLMEIISNRLKNREYIKKRYLHTGIIPVPKETTFSQVDESFLLKVNKTIQENLSNTNLDIQFICKEIGLSRTSLYTKLKALTGIGANDYINKFRIEKALTLIANTEMTFTEISEEVGFTSPSYFSTAFKQYTGETPTQYKEKTSKI q8a993_bactn BT_0924 protein protein bactn Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) MTMRTNCFLLLTVLLGILPMSNTHANDSIPKSVILYTPYTKISVSPGASIDYSIDLINNTDKLVNANLSVSGLSSSWKHEMKSGGWNLSQLAVLPKEKKTFNLKVDVPLKVSRGSYHFVVSAGEAQLPLNVVVAQQGTYQTEFTTDQPNMQGNSKSTFTFNATLKNQTADQQLYALMAKAPRGWNVIFKPNYKQATSAQVEANSSQNVSIDITPPANVEAGSYKIPVRAATGNTSAELELEVVVTGSYQMELTTPRGLLSSDVTAGDTKRIELEIKNTGSSLLKDIQLSANKPVDWDVAFEPSKIEMLKAGETATVVAILKASKKALPGDYVTTMMAKTPEVNADAQFRIAVKTPMIWGWVGVLIILATIGVVYYLFRKYGRR g6pi_bactn Glucose-6-phosphate isomerase pgi Phosphoglucose isomerase Phosphohexose isomerase BT_2124 protein protein bactn Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) MISLNIEKTFGFISKEKVSAYEAEVKAAQEMLEKGTGEGNDFLGWLHLPSSISKEHLADLNATAKVLRDNCEVVIVAGIGGSYLGARAVIEALSNSFTWLQDKKTAPVMIYAGHNISEDYLYELTEYLKDKKFGVINISKSGTTTETALAFRLLKKQCEDQRGKETAKKVIVAVTDAKKGAARVTADKEGYKTFIIPDNVGGRFSVLTPVGLLPIAVAGFDIDKLVAGAADMEKACGSDVPFAENPAAIYAATRNELYRQGKKIEILVNFCPKLHYVSEWWKQLYGESEGKDNKGIFPASVDFSTDLHSMGQWIQEGERSIFETVISLDKVDHKLEVPFDEANLDGLNFLAGKRVDEVNKMAELGTQLAHVDGGVPNMRIVLPELSEYNIGGLLYFFEKACGISGYLLGVNPFNQPGVEAYKKNMFALLNKPGYEEESKAIQAKL q8ab44_bactn BT_0267 protein protein bactn Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) MNSDSYLYFNIAQEIRLYINSTMKHQLKFYIVLFFIQLFPCAFAQQMSVSTLPLNNYLPSSTVLRVHCDREGFLWLGTKDGLCRYDGYRLLVFRSGLKSPDLLTNNEITCIAENKNGYLFIGTKKGINILDKRTYQIIPVTHNDLKDQEIRTMIVDSDGWVWVGTLTSVFRCSADFSYCKRYDSTLPVTSVNSIYEDADKNIWVTLWERGLHRYNSKTDSFIAMPQIGDLNNPFKVFQDNKKQHWILTWESGIFLLYPEEKDDLMYSHVDIKSNEHWDKNGCFSITQDDKYGYIWIVSTQGLYALQKRPGNIINTVDISHISSKLNNIFSEIVKDKSGNLWIAAFNEGVSMIDLNKPLVQNYSFPVIREKTGFVTNIKNIYEDKEGDLWIDQNRWGIGIYNPDSNKLLFYTDIPSLKNIANLKNVSCITSVPLLNEIWLGSEYYPEIYKVKKDKKGVELLGTLKLTDYVDNSGFPRLFYTDSNHNLWVGTTKGILVKPAKEKILQDTKFPFVDIIGIREGKDGSLWISTRKQGVYNAKISSDLTLEEKNLRNLKTHAEGVISDNIGAICVDDNGLVWMGSQDGDVFTYDPQTNKVENLSDMFDMLEEGIFNIITDQLGHIWISTNKRVIEYDPKNGGIMDYSTMTDVMVNSFMPNSYYKTRSGKILYGGNKGISVFTPYDHLSDNPRRIRTMVSDVKIDGVSSLLEKNNQRFNLRSQIISLNAGDKNIEIDFSSLNYAFPDKIKYAYKMDGVDDDWVYVRGDRQFAFYNQLPKGKRTFYLKTTDVNGLWSNYIAEVQVFKQPAFYETLWAYLFYIVFTLLCLYLFYHRMKRRIQLRHELRIAQIDKEKSEELVQTKLRYFTNISHDLLTPLTIITCLIDDAEMTNGSRISQLTMIRSNVNKLRRLLQQILDFRKVESGNMKLSVSKSDVISFIDDVCKIHFTPLMRKKNQTFTFLTEDRHLMAYFDRDKLDKIVSNLLSNAYKYTANGGNIKLIVDSYWESENHHLRIQVVDTGEGIAPADLENVFKRFYTINKGDESESNGIGLSLTKDLVELHHGTINVESELGKGSTFTVDLPINKDSYQEDELISEHISANGINTDLILEKEALADSQVGEDTQIADVHLLLVEDNEELLFLMEKILSKHYHVLIAKDGLEALNVIKDNEIDIIISDVMMPEMDGLEFCRALKSNLETSHIPIILLTAKNTVEDRIECYNAGADGYISKPFELKILEARINNFIMHKKNKQEEFRSNVEVNIDSLEPSSIDKEFLDKVISVINSNMSEGDFDVVQLADALAVSKSSLYRKMKLATGLSPIEFIRNIRLKHGSQLLKDKSISVAEVAYECGFSNPKYFATCFKEEFGVTPKEYQKSC q8a8e6_bactn Glucose-6-phosphate 1-dehydrogenase zwf BT_1221 protein protein bactn Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) MDKFAMIIFGASGDLTKRKLMPALYSLYRDKRLTGSFTVLGIGRTVYSDEDYRSYILGELQQFVKAEEQNLELMSSFVSHLYYLPMDPAKVEGYSQLRERLVELTKEVDPDNLLFYLATPPSLYGVVPLHLKAAGLNTPHSRIIVEKPFGYDLESALELNKIYSSVFDEHQIYRIDHFLGKETAQNVLAFRFANGIFEPLWNRNYIDYVEITAVENLGIEQRGGFYETAGALRDMVQNHLIQLVALTAMEPPAVFNADNFRNEVVKVYESLTPLTETDLNEHIVRGQYTASGNKKGYREEKGVAPDSRTETYIAMKLGISNWRWSGVPFYIRTGKQMPTKVTEIVVHFRETPHQMFRCSGGNCPRANKLILRLQPNEGIVLKIGMKVPGAGFEVRQVTMDFSYAQLGGVPSGDAYARLIDDCIQGDPTLFTRSDAVEASWNFFDPVLRYWKDNPDAPLYGYPAGTWGPLESEAMMHEHGADWTNPCKNLTNTDQYCEL q8a2k3_bactn BT_3302 protein protein bactn Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) MKKHNEWTKRTTLLRRVLLILVSFLLIGVDINASYSLRQFSSKNGLSNSAILSMCQDRHGVIWIGSCDGLNIYDGTYLGLYKPTNVHHSFSGNLIERIIEADNDVLWIQTNYGLDRFDTRRQTIQSFKDFKYINRMAISPEDDFFIIKDDGYIYYYQPEQKDFCKLDVKKIHFEEVQQMAIDNFGVLWIFSSDNDNRSYIIEKNGNQVKLVPSNCLNHSEKLLWTFVDGDFLYFIDSTYALYEYDLNNHKAYFIADMEAEILRRGEVSSIIKQKTDYFIGFKSSGLIQLKYMPDSKVKYSLQSINVQSGIFCLMKDRFQDIIWVGADGQGLYMYFTDEFSIDNIMLDVPEYRVDNPVRALYQDQDQTLWIGTKGGGILKMFDFHPDMETLPRAERILASNSPLMDNSVYSFAPSRRKLLWIGTESGLNYYSYSQKRIQEFPVMADGKMVKYVHSVRETNDSTLWVVSAGEGIVKIILDATSLLPKVKSARRFTLDGGKRNSNYFFVSFQENDSVIWFGNRGYGAYKMNTHTNQLTPCRIDDVVKNQTVNDIFAIHKNDEGYWFGTSFGLTRLYQGEYRVYNETDGFPNNTIHGILEGRDNNLWLSTNQGLVRFNVRENTVQTYRQQGDLEVIEFSDGAFFKDQQTGTLFFGGTNGFITISENDQLSEEYMPPLHFNRLSIFGKECNIYDFLQGATKQETLVLDYSQNFFNLSFIAVDYINGNNYTYSYKIDGLSDSWIENGLSTVAVFSNLSPGEYTLLVKYRSNITGKESEPYSLLIRITPPWYMTTCAYIVYFLLLAGVIAGAIRMVIKRYRRKRNVMIEEMNRQQREELYESKLRFFTNITHEFCTPLTLINGPCEKILSYSRVDSYVRKYASMIQQNALKLNALILELIEFRRLETGNKILKIKHVPVTEQIRTIAESFGELAESRKLNYRLQIEDGVFWNTDVSCLSKIVNNLISNAFKYTPENGSITVELRIEGEQLCIRVSNTGKGIKEADLTKIFDRYKILDNFEVQNKNGISPRNGLGLAICHSMVNLLNGQIQVSSIPNEVTTFDVWLPVMEVTVDNEDEKVAEELVLSSDEQAVELKNSSVEFDKNKQTIMIIDDDPSMLWFVTEIFVGAYNVVSLGSAEEALKQLGIQLPDLIISDVMMPGMDGMSFAKKIKSDKLLSRIPLILLSALNNIDEQTRGIESGAEAYITKPFNVEYLEKVVRRLLQREEDLKEYYSSVLSAFELDDGHFLHKEDKSFFEKMMQIIDSHIQNTDLSVELLSSSLGYSTRQFYRKLKNVTEKTPADIIREYRLTIVERLLLTTQLSIEEIMDKTGFSNRGTFYKAFAQKFEMTPKQYRNIKTKDVHEASEEGGGTMNV q8a2y3_bactn-q8a993_bactn-1 3144506 N/A 3144515 unspecified role unspecified role bait bait Region 1-745 Region 1-745 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3144516 unspecified role unspecified role prey prey Region 77-152 Region 77-152 sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q8a2y3_bactn-pgi-1 3144507 N/A 3144517 unspecified role unspecified role prey prey Region 228-352 Region 228-352 sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3144515 unspecified role unspecified role bait bait Region 1-745 Region 1-745 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q8a2y3_bactn-pgi-2 3144508 N/A 3144517 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3144515 unspecified role unspecified role bait bait Region 1-299 Region 1-299 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false pgi-q8a2y3_bactn-1 3144509 N/A 3144517 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3144515 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q8a993_bactn-q8ab44_bactn-1 3144510 N/A 3144518 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3144516 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q8a2y3_bactn-zwf-1 3144511 N/A 3144519 unspecified role unspecified role prey prey Region 309-464 Region 309-464 sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3144515 unspecified role unspecified role bait bait Region 1-745 Region 1-745 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false zwf-q8a2y3_bactn-1 3144512 N/A 3144519 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3144515 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q8a2y3_bactn-zwf-2 3144513 N/A 3144519 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3144515 unspecified role unspecified role bait bait Region 1-299 Region 1-299 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q8a993_bactn-q8a2k3_bactn-1 3144514 N/A 3144520 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3144516 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false