DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ sohn-2006-1 mouse Mus musculus Mouse fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Sohn HW., Tolar P., Jin T., Pierce SK. DIP original experiment: DIP-263152X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Fluorescence resonance energy transfer in living cells reveals dynamic membrane changes in the initiation of B cell signaling. Sohn HW., Tolar P., Jin T., Pierce SK. Only protein-protein interactions imex curation sohn-2006-2 mouse Mus musculus Mouse fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Sohn HW., Tolar P., Jin T., Pierce SK. DIP original experiment: DIP-263153X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Fluorescence resonance energy transfer in living cells reveals dynamic membrane changes in the initiation of B cell signaling. Sohn HW., Tolar P., Jin T., Pierce SK. Only protein-protein interactions imex curation lyn_mouse Tyrosine-protein kinase Lyn Lyn V-yes-1 Yamaguchi sarcoma viral related oncogene homolog p53Lyn p56Lyn protein protein mouse Mus musculus Mouse MGCIKSKRKDNLNDDEVDSKTQPVRNTDRTIYVRDPTSNKQQRPVPEFHLLPGQRFQTKDPEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLSSKREGFIPSNYVAKVNTLETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESETLKGSFSLSVRDYDPMHGDVIKHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQSDGLCRRLEKACISPKPQKPWDKDAWEIPRESIKLVKKLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHDKLVRLYAVVTKEEPIYIITEFMAKGSLLDFLKSDEGGKVLLPKLIDFSAQIAEGMAYIERKNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCFTIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMSALSQGYRMPRMENCPDELYDIMKMCWKEKAEERPTFDYLQSVLDDFYTATEGQYQQQP cd79a_mouse B-cell antigen receptor complex-associated protein alpha chain Cd79a Iga Mb-1 Ig-alpha MB-1 membrane glycoprotein Membrane-bound immunoglobulin-associated protein Surface IgM-associated protein protein protein mouse Mus musculus Mouse MPGGLEALRALPLLLFLSYACLGPGCQALRVEGGPPSLTVNLGEEARLTCENNGRNPNITWWFSLQSNITWPPVPLGPGQGTTGQLFFPEVNKNHRGLYWCQVIENNILKRSCGTYLRVRNPVPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFRKRWQNEKFGVDMPDDYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGNLHIGDAQLEKP cd79a-lyn-1 3144066 N/A 3144068 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept YFP-tag YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false mouse Mus musculus Mouse N/A 3144069 unspecified role unspecified role fluorescence donor fluorescence donor CFP-tag CFP-tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false mouse Mus musculus Mouse proximity proximity close-contact colocalization neighbourhood interaction false false false lyn-cd79a-1 3144067 N/A 3144068 unspecified role unspecified role fluorescence donor fluorescence donor CFP-tag CFP-tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false mouse Mus musculus Mouse N/A 3144069 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept YFP-tag YFP-tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false mouse Mus musculus Mouse proximity proximity close-contact colocalization neighbourhood interaction false false false