DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ strong-2006-1 ecolx Escherichia coli pull down pull down weight by staining molecular weight estimation by staining weight by staining Strong M., Sawaya MR., Wang S., Phillips M., Cascio D., Eisenberg D. DIP original experiment: DIP-263149X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Toward the structural genomics of complexes: crystal structure of a PE/PPE protein complex from Mycobacterium tuberculosis. Strong M., Sawaya MR., Wang S., Phillips M., Cascio D., Eisenberg D. Only protein-protein interactions imex curation strong-2006-2 ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Strong M., Sawaya MR., Wang S., Phillips M., Cascio D., Eisenberg D. DIP original experiment: DIP-263150X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Toward the structural genomics of complexes: crystal structure of a PE/PPE protein complex from Mycobacterium tuberculosis. Strong M., Sawaya MR., Wang S., Phillips M., Cascio D., Eisenberg D. Only protein-protein interactions imex curation strong-2006-3 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Strong M., Sawaya MR., Wang S., Phillips M., Cascio D., Eisenberg D. DIP original experiment: DIP-263151X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Toward the structural genomics of complexes: crystal structure of a PE/PPE protein complex from Mycobacterium tuberculosis. Strong M., Sawaya MR., Wang S., Phillips M., Cascio D., Eisenberg D. Only protein-protein interactions imex curation ppe41_myctu PPE family protein PPE41 Rv2430c PPE41 LH57_13290 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MHFEAYPPEVNSANIYAGPGPDSMLAAARAWRSLDVEMTAVQRSFNRTLLSLMDAWAGPVVMQLMEAAKPFVRWLTDLCVQLSEVERQIHEIVRAYEWAHHDMVPLAQIYNNRAERQILIDNNALGQFTAQIADLDQEYDDFWDEDGEVMRDYRLRVSDALSKLTPWKAPPPIAHSTVLVAPVSPSTASSRTDT mint pe25_myctu PE-PGRS family protein PE25 PE25 LH57_13295 Rv2431c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MSFVITNPEALTVAATEVRRIRDRAIQSDAQVAPMTTAVRPPAADLVSEKAATFLVEYARKYRQTIAAAAVVLEEFAHALTTGADKYATAEADNIKTFS ppe41-pe25-1 3144051 N/A 3144054 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3144055 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association false false false pe25-ppe41-2 3144052 N/A 3144054 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3144055 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false pe25-ppe41-3 3144053 N/A 3144054 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3144055 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false