DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ bullock-2006-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Bullock AN., Debreczeni JE., Edwards AM., Sundström M., Knapp S. DIP original experiment: DIP-262911X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Crystal structure of the SOCS2-elongin C-elongin B complex defines a prototypical SOCS box ubiquitin ligase. Bullock AN., Debreczeni JE., Edwards AM., Sundström M., Knapp S. Only protein-protein interactions imex curation bullock-2006-2 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Bullock AN., Debreczeni JE., Edwards AM., Sundström M., Knapp S. DIP original experiment: DIP-262913X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Crystal structure of the SOCS2-elongin C-elongin B complex defines a prototypical SOCS box ubiquitin ligase. Bullock AN., Debreczeni JE., Edwards AM., Sundström M., Knapp S. Only protein-protein interactions imex curation bullock-2006-3 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Bullock AN., Debreczeni JE., Edwards AM., Sundström M., Knapp S. DIP original experiment: DIP-262914X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Crystal structure of the SOCS2-elongin C-elongin B complex defines a prototypical SOCS box ubiquitin ligase. Bullock AN., Debreczeni JE., Edwards AM., Sundström M., Knapp S. Only protein-protein interactions imex curation bullock-2006-4 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Bullock AN., Debreczeni JE., Edwards AM., Sundström M., Knapp S. DIP original experiment: DIP-262912X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Crystal structure of the SOCS2-elongin C-elongin B complex defines a prototypical SOCS box ubiquitin ligase. Bullock AN., Debreczeni JE., Edwards AM., Sundström M., Knapp S. Only protein-protein interactions imex curation q15369-1 Elongin-C ELOC TCEB1 Elongin 15 kDa subunit RNA polymerase II transcription factor SIII subunit C SIII p15 Transcription elongation factor B polypeptide 1 protein protein human Homo sapiens Human MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC q15370-1 Elongin-B ELOB TCEB2 Elongin 18 kDa subunit RNA polymerase II transcription factor SIII subunit B SIII p18 Transcription elongation factor B polypeptide 2 protein protein human Homo sapiens Human MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ socs2_human Suppressor of cytokine signaling 2 Cytokine-inducible SH2 protein 2 STAT-induced STAT inhibitor 2 CIS2 SSI2 STATI2 SOCS2 protein protein human Homo sapiens Human MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV ghr peptide GHR peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) PVPDYTSIHIV epor peptide EpoR peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) ASFEYTILDPS elob-eloc-1 3143997 N/A 3144001 unspecified role unspecified role unspecified role unspecified role Region 17-112 Region 17-112 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3144002 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3144003 unspecified role unspecified role unspecified role unspecified role Region 32-198 Region 32-198 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli physical association physical association false false false ghr peptide-socs2-1 3143998 N/A 3144004 unspecified role unspecified role unspecified role unspecified role in vitro In vitro N/A 3144003 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false epor peptide-socs2-1 3143999 N/A 3144005 unspecified role unspecified role unspecified role unspecified role in vitro In vitro N/A 3144003 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false elob-eloc-2 3144000 N/A 3144001 unspecified role unspecified role unspecified role unspecified role Region 17-112 Region 17-112 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3144002 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3144003 unspecified role unspecified role unspecified role unspecified role Region 32-198 Region 32-198 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false