DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ giglia_mari-2006-1 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Giglia-Mari G., Miquel C., Theil AF., Mari PO., Hoogstraten D., Ng JM., Dinant C., Hoeijmakers JH., Vermeulen W. DIP original experiment: DIP-66451X PLoS biology 2006 IMEx Dynamic interaction of TTDA with TFIIH is stabilized by nucleotide excision repair in living cells. Giglia-Mari G., Miquel C., Theil AF., Mari PO., Hoogstraten D., Ng JM., Dinant C., Hoeijmakers JH., Vermeulen W. Only protein-protein interactions imex curation giglia_mari-2006-2 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Giglia-Mari G., Miquel C., Theil AF., Mari PO., Hoogstraten D., Ng JM., Dinant C., Hoeijmakers JH., Vermeulen W. DIP original experiment: DIP-66452X PLoS biology 2006 IMEx Dynamic interaction of TTDA with TFIIH is stabilized by nucleotide excision repair in living cells. Giglia-Mari G., Miquel C., Theil AF., Mari PO., Hoogstraten D., Ng JM., Dinant C., Hoeijmakers JH., Vermeulen W. Only protein-protein interactions imex curation giglia_mari-2006-3 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Giglia-Mari G., Miquel C., Theil AF., Mari PO., Hoogstraten D., Ng JM., Dinant C., Hoeijmakers JH., Vermeulen W. DIP original experiment: DIP-66453X PLoS biology 2006 IMEx Dynamic interaction of TTDA with TFIIH is stabilized by nucleotide excision repair in living cells. Giglia-Mari G., Miquel C., Theil AF., Mari PO., Hoogstraten D., Ng JM., Dinant C., Hoeijmakers JH., Vermeulen W. Only protein-protein interactions imex curation ercc3_human General transcription and DNA repair factor IIH helicase subunit XPB ERCC3 XPB XPBC Basic transcription factor 2 89 kDa subunit TFIIH basal transcription factor complex 89 kDa subunit DNA repair protein complementing XP-B cells Xeroderma pigmentosum group B-complementing protein DNA excision repair protein ERCC-3 protein protein human Homo sapiens Human MGKRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGKQVDESGTKVDEYGAKDYRLQMPLKDDHTSRPLWVAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPTHVHEYKLTAYSLYAAVSVGLQTSDITEYLRKLSKTGVPDGIMQFIKLCTVSYGKVKLVLKHNRYFVESCHPDVIQHLLQDPVIRECRLRNSEGEATELITETFTSKSAISKTAESSGGPSTSRVTDPQGKSDIPMDLFDFYEQMDKDEEEEEETQTVSFEVKQEMIEELQKRCIHLEYPLLAEYDFRNDSVNPDINIDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRKRCLVLGNSAVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKPIGCSVAISTYSMLGHTTKRSWEAERVMEWLKTQEWGLMILDEVHTIPAKMFRRVLTIVQAHCKLGLTATLVREDDKIVDLNFLIGPKLYEANWMELQNNGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPNKFRACQFLIKFHERRNDKIIVFADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNPKINTIFISKVGDTSFDLPEANVLIQISSHGGSRRQEAQRLGRVLRAKKGMVAEEYNAFFYSLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAGMEEEDLAFSTKEEQQQLLQKVLAATDLDAEEEVVAGEFGSRSSQASRRFGTMSSMSGADDTVYMEYHSSRSKAPSKHVHPLFKRFRK tf2h5_human General transcription factor IIH subunit 5 TFIIH subunit p8 GTF2H5 C6orf175 TTDA General transcription factor IIH polypeptide 5 TFB5 ortholog TFIIH basal transcription factor complex TTD-A subunit protein protein human Homo sapiens Human MVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDIDDTHVFVIAELVNVLQERVGELMDQNAFSLTQK tf2h2_human General transcription factor IIH subunit 2 General transcription factor IIH polypeptide 2 TFIIH basal transcription factor complex p44 subunit Basic transcription factor 2 44 kDa subunit GTF2H2 BTF2P44 protein protein human Homo sapiens Human MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEPSLYNSLSIAMQTLKHMPGHTSREVLIIFSSLTTCDPSNIYDLIKTLKAAKIRVSVIGLSAEVRVCTVLARETGGTYHVILDESHYKELLTHHVSPPPASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGCQGELKDQHVYVCAVCQNVFCVDCDVFVHDSLHCCPGCIHKIPAPSGV ercc2_human General transcription and DNA repair factor IIH helicase subunit XPD ERCC2 XPD XPDC Basic transcription factor 2 80 kDa subunit CXPD DNA excision repair protein ERCC-2 DNA repair protein complementing XP-D cells TFIIH basal transcription factor complex 80 kDa subunit Xeroderma pigmentosum group D-complementing protein protein protein human Homo sapiens Human MKLNVDGLLVYFPYDYIYPEQFSYMRELKRTLDAKGHGVLEMPSGTGKTVSLLALIMAYQRAYPLEVTKLIYCSRTVPEIEKVIEELRKLLNFYEKQEGEKLPFLGLALSSRKNLCIHPEVTPLRFGKDVDGKCHSLTASYVRAQYQHDTSLPHCRFYEEFDAHGREVPLPAGIYNLDDLKALGRRQGWCPYFLARYSILHANVVVYSYHYLLDPKIADLVSKELARKAVVVFDEAHNIDNVCIDSMSVNLTRRTLDRCQGNLETLQKTVLRIKETDEQRLRDEYRRLVEGLREASAARETDAHLANPVLPDEVLQEAVPGSIRTAEHFLGFLRRLLEYVKWRLRVQHVVQESPPAFLSGLAQRVCIQRKPLRFCAERLRSLLHTLEITDLADFSPLTLLANFATLVSTYAKGFTIIIEPFDDRTPTIANPILHFSCMDASLAIKPVFERFQSVIITSGTLSPLDIYPKILDFHPVTMATFTMTLARVCLCPMIIGRGNDQVAISSKFETREDIAVIRNYGNLLLEMSAVVPDGIVAFFTSYQYMESTVASWYEQGILENIQRNKLLFIETQDGAETSVALEKYQEACENGRGAILLSVARGKVSEGIDFVHHYGRAVIMFGVPYVYTQSRILKARLEYLRDQFQIRENDFLTFDAMRHAAQCVGRAIRGKTDYGLMVFADKRFARGDKRGKLPRWIQEHLTDANLNLTVDEGVQVAKYFLRQMAQPFHREDQLGLSLLSLEQLESEETLKRIEQIAQQL gtf2h5-ercc3-1 3143942 N/A 3143945 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3143946 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human direct interaction direct interaction false false false gtf2h2-gtf2h5-1 3143943 N/A 3143947 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3143946 unspecified role unspecified role prey prey GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human direct interaction direct interaction false false false ercc2-ercc3-1 3143944 N/A 3143948 unspecified role unspecified role bait bait GFP-tag GFP-tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3143945 unspecified role unspecified role prey prey human Homo sapiens Human direct interaction direct interaction false false false