DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ schwartz-2006-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Schwartz TU., Schmidt D., Brohawn SG., Blobel G. DIP original experiment: DIP-262881X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Homodimerization of the G protein SRbeta in the nucleotide-free state involves proline cis/trans isomerization in the switch II region. Schwartz TU., Schmidt D., Brohawn SG., Blobel G. Only protein-protein interactions imex curation schwartz-2006-2 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Schwartz TU., Schmidt D., Brohawn SG., Blobel G. DIP original experiment: DIP-262884X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Homodimerization of the G protein SRbeta in the nucleotide-free state involves proline cis/trans isomerization in the switch II region. Schwartz TU., Schmidt D., Brohawn SG., Blobel G. Only protein-protein interactions imex curation schwartz-2006-3 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Schwartz TU., Schmidt D., Brohawn SG., Blobel G. DIP original experiment: DIP-262882X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Homodimerization of the G protein SRbeta in the nucleotide-free state involves proline cis/trans isomerization in the switch II region. Schwartz TU., Schmidt D., Brohawn SG., Blobel G. Only protein-protein interactions imex curation schwartz-2006-4 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Schwartz TU., Schmidt D., Brohawn SG., Blobel G. DIP original experiment: DIP-262885X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Homodimerization of the G protein SRbeta in the nucleotide-free state involves proline cis/trans isomerization in the switch II region. Schwartz TU., Schmidt D., Brohawn SG., Blobel G. Only protein-protein interactions imex curation schwartz-2006-5 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Schwartz TU., Schmidt D., Brohawn SG., Blobel G. DIP original experiment: DIP-262883X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Homodimerization of the G protein SRbeta in the nucleotide-free state involves proline cis/trans isomerization in the switch II region. Schwartz TU., Schmidt D., Brohawn SG., Blobel G. Only protein-protein interactions imex curation schwartz-2006-6 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Schwartz TU., Schmidt D., Brohawn SG., Blobel G. DIP original experiment: DIP-262886X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Homodimerization of the G protein SRbeta in the nucleotide-free state involves proline cis/trans isomerization in the switch II region. Schwartz TU., Schmidt D., Brohawn SG., Blobel G. Only protein-protein interactions imex curation srpb_yeast Signal recognition particle receptor subunit beta SRP102 YKL609 YKL154W protein protein yeast Saccharomyces cerevisiae Baker's yeast MLSNTLIIACLLVIGTTIALIAVQKASSKTGIKQKSYQPSIIIAGPQNSGKTSLLTLLTTDSVRPTVVSQEPLSAADYDGSGVTLVDFPGHVKLRYKLSDYLKTRAKFVKGLIFMVDSTVDPKKLTTTAEFLVDILSITESSCENGIDILIACNKSELFTARPPSKIKDALESEIQKVIERRKKSLNEVERKINEEDYAENTLDVLQSTDGFKFANLEASVVAFEGSINKRKISQWREWIDEKL EA4AE9126B2A04B5 srprb_human Signal recognition particle receptor subunit beta SRPRB PSEC0230 Protein APMCF1 protein protein human Homo sapiens Human MASADSRRVADGGGAGGTFQPYLDTLRQELQQTDPTLLSVVVAVLAVLLTLVFWKLIRSRRSSQRAVLLVGLCDSGKTLLFVRLLTGLYRDTQTSITDSCAVYRVNNNRGNSLTLIDLPGHESLRLQFLERFKSSARAIVFVVDSAAFQREVKDVAEFLYQVLIDSMGLKNTPSFLIACNKQDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQLGKKGKEFEFSQLPLKVEFLECSAKGGRGDVGSADIQDLEKWLAKIA q6dgw3_danre Signal recognition particle receptor subunit beta srprb zgc:92746 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MEERVDLDLEDFSSEPFLETFLKEIQNEDAVFLVGIFVALALVILTIVFFGNFWGSSKVRNAVLLLGLCDSGKTLLFTRLLLGKFVRTQTSITESSATYKSKSERGNSWTLIDVPGHESLRTQIVEKYKDVARAIVFVVDSSIFQKDVRDVAEFLYSILTDSILAKNAPTLVVACNKQDITMAKSAKLIQQQLEKELNTLRLTRSAALSSQDGAVGGSVYLGKKGKDFEFSQLANRVEFIECKARGSKTEDGDADIDALEKCLAKL srpr_yeast Signal recognition particle receptor subunit alpha homolog SRP101 YDR292C D9819.3 Docking protein alpha protein protein yeast Saccharomyces cerevisiae Baker's yeast MFDQLAVFTPQGQVLYQYNCLGKKFSEIQINSFISQLITSPVTRKESVANANTDGFDFNLLTINSEHKNSPSFNALFYLNKQPELYFVVTFAEQTLELNQETQQTLALVLKLWNSLHLSESILKNRQGQNEKNKHNYVDILQGIEDDLKKFEQYFRIKYEESIKQDHINPDNFTKNGSVPQSHNKNTKKKLRDTKGKKQSTGNVGSGRKWGRDGGMLDEMNHEDAAKLDFSSSNSHNSSQVALDSTINKDSFGDRTEGGDFLIKEIDDLLSSHKDEITSGNEAKNSGYVSTAFGFLQKHVLGNKTINESDLKSVLEKLTQQLITKNVAPEAADYLTQQVSHDLVGSKTANWTSVENTARESLTKALTQILTPGVSVDLLREIQSKRSKKDEEGKCDPYVFSIVGVNGVGKSTNLSKLAFWLLQNNFKVLIVACDTFRSGAVEQLRVHVENLAQLMDDSHVRGSKNKRGKTGNDYVELFEAGYGGSDLVTKIAKQAIKYSRDQNFDIVLMDTAGRRHNDPTLMSPLKSFADQAKPDKIIMVGEALVGTDSVQQAKNFNDAFGKGRNLDFFIISKCDTVGEMLGTMVNMVYATGIPILFVGVGQTYTDLRTLSVKWAVNTLMS 032400E5B3310C91 q22013_caeel Signal recognition particle receptor subunit beta CELE_R186.3 R186.3 protein protein caeel Caenorhabditis elegans MDKIDFNDPTTLAVLATAVIGLLTVLLLVLKSFASSNKNRVLFVGLMDCGKTTIFTQLSQKEAEYPTTTKTYTSMVENKITLRIKDKEKEIIDYPGNDRLRQKLIENHLHSRSLLRIVFVVDSAAFSKNARDVAELFYTVALENVDKVPILIACHKQDLSLAKTEKVIRNSLEKEIGLINKSRAAALIGTDGSEEKRSTLTDTGIDFKWEDLKKQEVSFVSTSSNSEDFGVHEIASFVRA sr_beta-1 3143791 N/A 3143797 unspecified role unspecified role unspecified role unspecified role Region 31-244 Region 31-244 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false srprb-1 3143792 N/A 3143798 unspecified role unspecified role unspecified role unspecified role Region 59-271 Region 59-271 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false sr_beta-2 3143793 N/A 3143797 unspecified role unspecified role unspecified role unspecified role Region 31-244 Region 31-244 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false srprb-2 3143794 N/A 3143799 unspecified role unspecified role unspecified role unspecified role Region 60-266 Region 60-266 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false sr_alpha-sr_beta-1 3143795 N/A 3143800 unspecified role unspecified role unspecified role unspecified role Region 1-158 Region 1-158 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3143797 unspecified role unspecified role unspecified role unspecified role Region 31-244 Region 31-244 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false q22013_caeel-1 3143796 N/A 3143801 unspecified role unspecified role unspecified role unspecified role Region 28-240 Region 28-240 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false