DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ legrand-2006-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Legrand P., Dumas R., Seux M., Rippert P., Ravelli R., Ferrer JL., Matringe M. DIP original experiment: DIP-66277X Structure (London, England : 1993) 2006 IMEx Biochemical characterization and crystal structure of Synechocystis arogenate dehydrogenase provide insights into catalytic reaction. Legrand P., Dumas R., Seux M., Rippert P., Ravelli R., Ferrer JL., Matringe M. Only protein-protein interactions imex curation legrand-2006-2 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Legrand P., Dumas R., Seux M., Rippert P., Ravelli R., Ferrer JL., Matringe M. DIP original experiment: DIP-66278X Structure (London, England : 1993) 2006 IMEx Biochemical characterization and crystal structure of Synechocystis arogenate dehydrogenase provide insights into catalytic reaction. Legrand P., Dumas R., Seux M., Rippert P., Ravelli R., Ferrer JL., Matringe M. Only protein-protein interactions imex curation legrand-2006-3 ecolx Escherichia coli bn-page blue native page bn-page predetermined predetermined participant predetermined Legrand P., Dumas R., Seux M., Rippert P., Ravelli R., Ferrer JL., Matringe M. DIP original experiment: DIP-66279X Structure (London, England : 1993) 2006 IMEx Biochemical characterization and crystal structure of Synechocystis arogenate dehydrogenase provide insights into catalytic reaction. Legrand P., Dumas R., Seux M., Rippert P., Ravelli R., Ferrer JL., Matringe M. Only protein-protein interactions imex curation p73906_syny3 tyrA protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MKIGVVGLGLIGASLAGDLRRRGHYLIGVSRQQSTCEKAVERQLVDEAGQDLSLLQTAKIIFLCTPIQLILPTLEKLIPHLSPTAIVTDVASVKTAIAEPASQLWSGFIGGHPMAGTAAQGIDGAEENLFVNAPYVLTPTEYTDPEQLACLRSVLEPLGVKIYLCTPADHDQAVAWISHLPVMVSAALIQACAGEKDGDILKLAQNLASSGFRDTSRVGGGNPELGTMMATYNQRALLKSLQDYRQHLDQLITLISNQQWPELHRLLQQTNGDRDKYVE 492144A2C2DBCC88 tyrasy-1 3143559 N/A 3143562 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false tyrasy-2 3143560 N/A 3143562 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false tyrasy-3 3143561 N/A 3143562 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false