DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ lettau-2006-1 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Lettau M., Qian J., Linkermann A., Latreille M., Larose L., Kabelitz D., Janssen O. DIP original experiment: DIP-262832X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The adaptor protein Nck interacts with Fas ligand: Guiding the death factor to the cytotoxic immunological synapse. Lettau M., Qian J., Linkermann A., Latreille M., Larose L., Kabelitz D., Janssen O. Only protein-protein interactions imex curation lettau-2006-2 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Lettau M., Qian J., Linkermann A., Latreille M., Larose L., Kabelitz D., Janssen O. DIP original experiment: DIP-262834X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The adaptor protein Nck interacts with Fas ligand: Guiding the death factor to the cytotoxic immunological synapse. Lettau M., Qian J., Linkermann A., Latreille M., Larose L., Kabelitz D., Janssen O. Only protein-protein interactions imex curation lettau-2006-3 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Lettau M., Qian J., Linkermann A., Latreille M., Larose L., Kabelitz D., Janssen O. DIP original experiment: DIP-262836X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The adaptor protein Nck interacts with Fas ligand: Guiding the death factor to the cytotoxic immunological synapse. Lettau M., Qian J., Linkermann A., Latreille M., Larose L., Kabelitz D., Janssen O. Only protein-protein interactions imex curation lettau-2006-4 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Lettau M., Qian J., Linkermann A., Latreille M., Larose L., Kabelitz D., Janssen O. DIP original experiment: DIP-262833X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The adaptor protein Nck interacts with Fas ligand: Guiding the death factor to the cytotoxic immunological synapse. Lettau M., Qian J., Linkermann A., Latreille M., Larose L., Kabelitz D., Janssen O. Only protein-protein interactions imex curation lettau-2006-5 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Lettau M., Qian J., Linkermann A., Latreille M., Larose L., Kabelitz D., Janssen O. DIP original experiment: DIP-262835X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The adaptor protein Nck interacts with Fas ligand: Guiding the death factor to the cytotoxic immunological synapse. Lettau M., Qian J., Linkermann A., Latreille M., Larose L., Kabelitz D., Janssen O. Only protein-protein interactions imex curation p16333-1 Cytoplasmic protein NCK1 NCK1 NCK NCK adaptor protein 1 SH2/SH3 adaptor protein NCK-alpha protein protein human Homo sapiens Human MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKNSARKASIVKNLKDTLGIGKVKRKPSVPDSASPADDSFVDPGERLYDLNMPAYVKFNYMAEREDELSLIKGTKVIVMEKCSDGWWRGSYNGQVGWFPSNYVTEEGDSPLGDHVGSLSEKLAAVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKINGMVGLVPKNYVTVMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEMALNERGHEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRKFSTMEELVEHYKKAPIFTSEQGEKLYLVKHLS tnfl6_human Tumor necrosis factor ligand superfamily member 6 Fas antigen ligand CD95L Apoptosis antigen ligand FASLG APT1LG1 FASL TNFSF6 CD95 ligand protein protein human Homo sapiens Human MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL wasl_human Neural Wiskott-Aldrich syndrome protein WASL protein protein human Homo sapiens Human MSSVQQQPPPPRRVTNVGSLLLTPQENESLFTFLGKKCVTMSSAVVQLYAADRNCMWSKKCSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSEKRRDPPNGPNLPMATVDIKNPEITTNRFYGPQVNNISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPPPPSRGGPPPPPPPPHNSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPPPPNRMYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPPPGPPPPPGLPSDGDHQVPTTAGNKAALLDQIREGAQLKKVEQNSRPVSCSGRDALLDQIRQGIQLKSVADGQESTPPTPAPTSGIVGALMEVMQKRSKAIHSSDEDEDEDDEEDFEDDDEWED nck1-faslg-1 3143282 N/A 3143287 unspecified role unspecified role bait bait Region 109-164 Region 109-164 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Region 193-251 Region 193-251 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false P16333-1:p.[Trp38Lys;Trp143Lys;Trp229Lys] W38K/W143K/W229K mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3143288 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3143289 unspecified role unspecified role prey prey human Homo sapiens Human association association false false false nck1-faslg-2 3143283 N/A 3143287 unspecified role unspecified role bait bait P16333-1:p.Trp143Lys W143K mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P16333-1:p.Trp229Lys W229K mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3143288 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false faslg-nck1-2 3143284 N/A 3143287 unspecified role unspecified role prey prey P16333-1:p.[Trp38Lys;Trp143Lys;Trp229Lys] W38K/W143K/W229K mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3143288 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false nck1-wasl-1 3143285 N/A 3143287 unspecified role unspecified role bait bait Region 5-60 Region 5-60 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3143289 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false nck1-faslg-3 3143286 N/A 3143287 unspecified role unspecified role bait bait P16333-1:p.[Trp38Lys;Trp143Lys;Trp229Lys] W38K/W143K/W229K mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3143288 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false