DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ barrett-2006-1 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Barrett LE., Van Bockstaele EJ., Sul JY., Takano H., Haydon PG., Eberwine JH. DIP original experiment: DIP-262757X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Elk-1 associates with the mitochondrial permeability transition pore complex in neurons. Barrett LE., Van Bockstaele EJ., Sul JY., Takano H., Haydon PG., Eberwine JH. Only protein-protein interactions imex curation barrett-2006-2 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Barrett LE., Van Bockstaele EJ., Sul JY., Takano H., Haydon PG., Eberwine JH. DIP original experiment: DIP-262758X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Elk-1 associates with the mitochondrial permeability transition pore complex in neurons. Barrett LE., Van Bockstaele EJ., Sul JY., Takano H., Haydon PG., Eberwine JH. Only protein-protein interactions imex curation kcru_mouse Creatine kinase U-type, mitochondrial Ubiquitous mitochondrial creatine kinase Acidic-type mitochondrial creatine kinase Ckmt1 protein protein mouse Mus musculus Mouse MAGPFSRLLSARPGLRLLALAGAGSLTAGILLRPESVGAAAAERRRLYPPSAEYPDLRKHNNCMASHLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFAELFDPVIQERHNGYDPRTMKHTTDLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVERVVVDALSGLKGDLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVEKLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDNRFPKILENLRLQKRGTGGVDTAATGSVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPPPLVHSKH elk1_mouse ETS domain-containing protein Elk-1 Elk1 protein protein mouse Mus musculus Mouse MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKLSRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSAIAMAPATVHAGPGDTATGKPGTPKGAGMTGQGGLARSSRNEYMRSGLYSTFTIQSLQPQPQPPIPPRPASVLPNTTPAGVPAPASGSRSTSPNPLEACLEAEEAGLPLQVILTPPEAPNQKSEELSLDPSFGHPQPPEVKVEGPKEELEAARAGGFSSEAVKAEPEVSASEGLLARLPAILTENTAQVCGLSTSTTEITQPQKGRKPRDLELPLSPSLLGGQGPERTPGSGTSSGLQAPGPALTPSLLPTHTLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVVLSPGPQKP elk1-ckmt1-1 3142876 N/A 3142878 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3142879 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association false false false ckmt1-elk1-1 3142877 N/A 3142878 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3142879 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association false false false