DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ bosch-2006-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Bosch J., Turley S., Daly TM., Bogh SM., Villasmil ML., Roach C., Zhou N., Morrisey JM., Vaidya AB., Bergman LW., Hol WG. DIP original experiment: DIP-262742X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structure of the MTIP-MyoA complex, a key component of the malaria parasite invasion motor. Bosch J., Turley S., Daly TM., Bogh SM., Villasmil ML., Roach C., Zhou N., Morrisey JM., Vaidya AB., Bergman LW., Hol WG. Only protein-protein interactions imex curation bosch-2006-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Bosch J., Turley S., Daly TM., Bogh SM., Villasmil ML., Roach C., Zhou N., Morrisey JM., Vaidya AB., Bergman LW., Hol WG. DIP original experiment: DIP-262744X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structure of the MTIP-MyoA complex, a key component of the malaria parasite invasion motor. Bosch J., Turley S., Daly TM., Bogh SM., Villasmil ML., Roach C., Zhou N., Morrisey JM., Vaidya AB., Bergman LW., Hol WG. Only protein-protein interactions imex curation bosch-2006-3 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Bosch J., Turley S., Daly TM., Bogh SM., Villasmil ML., Roach C., Zhou N., Morrisey JM., Vaidya AB., Bergman LW., Hol WG. DIP original experiment: DIP-262743X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structure of the MTIP-MyoA complex, a key component of the malaria parasite invasion motor. Bosch J., Turley S., Daly TM., Bogh SM., Villasmil ML., Roach C., Zhou N., Morrisey JM., Vaidya AB., Bergman LW., Hol WG. Only protein-protein interactions imex curation d0vwv5_plakn protein protein plakn Plasmodium knowlesi KDMFNTKSSNGKLRIEDASHNARKLGLAPSSTDEKKIRDLYGDSLTYEQYLEYLTMCVHDRDNMEELIKMFSHFDNNSSGFLTKNQMKNILTTWGDALTEQEANDALNAFSSEDRINYKLFCEDIL myoa_playo Myosin-A MyoA PY01232 protein protein playo Plasmodium yoelii yoelii MAVTNEELKTAHKIVRRVSNIEAFDKSGVVFKGYQIWTNISPTIEEDPNVMFVKCVVQHGSNQDKLNVVQIDPPGSGTPYEIDVKSAWNCNSQVDPMSFGDIGLLNHTNTPCVLDFLKHRYLKNQIYTTACPLIVAINPYKDLGNTTDEWIRKYRDASDHTRLPPHIFSCAREALSNLHGVNKSQTIIVSGESGAGKTEATKQIMKYFASSKNGNMDLYIQTAIMAANPVLEAFGNAKTIRNNNSSRFGRFMQLAISHEGGIRNGSVVAFLLEKSRIITQDDNERSYHIFYQFLKGADSNMKSKFGLKGIKDYKLLNPNSPDVDGIDDVKDFQEVITSLKNMQLNDEQIEVIFSIIAGILTLGNVRIVEKTEAGLSDAAGIHNDDMETFKKACELMFLDPELVKRELLIKVTIAGGNRIEGRWNKNDAEVLKLSLCKAMYEKLFLWIIKNLNSRIEPEGGFKAFMGMLDIFGFEVFKNNSLEQLFINITNEMLQKNFVDIVFERESKLYRDEGISTAELNYTSNKEVISVLCERGKSVLSYLEDQCLAPGGSDEKFVNACVVNLKSNEKFIPAKVASNKNFIIQHTIGPIQYCSDNFLLKNKDVLRGELVEIILGSGNKVVSGLFEGQVIEKGKMAKGSLIGSQFLNQLTSLMTLINSTEPHFIRCIKPNENKKPLEWCEPKILIQLHALSILEALVLRQLGYSYRRTFDEFLYQFKFVDINTSENSSLDSREKCNKILKLSGLSDDMLKIGKTMVFLKQDGAKMLSKIQREKLVEWENCVSVIEAAIMKYKHKQNVENNVSSLMRVQAHIRKRMVA q7rsf0_playo Non-specific serine/threonine protein kinase PY00409 protein protein playo Plasmodium yoelii yoelii MEQQCHACYFELPDPKTTIGPYDSELNYFMWGPGFEWKPEPVVSQISGEDTYDETEESEESEHGFDELDEKVNKDDRKRYFDEKSSGGKISIENASHNARRLGLAPSSKDEEKIRELYGDNLTYDQYLEYLSMSIHDKDNAEQLVKMFAYFDTNTTGYLTKNQMKNILITWGDALTEDEAMNALNAFSNDDKIDYKLFCEDILQ d0vwv5_plakn-myoa_playo-1 3142770 N/A 3142773 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3142774 unspecified role unspecified role unspecified role unspecified role Region 803-817 Region 803-817 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false myoa_playo-q7rsf0_playo-1 3142771 N/A 3142774 unspecified role unspecified role bait bait Region 803-817 Region 803-817 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3142775 unspecified role unspecified role prey prey Q7RSF0:p.Phe148Ala F148A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q7RSF0:p.[Ile167Ala;Leu168Ala] I167A/L168A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q7RSF0:p.Asp173Ala D173A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q7RSF0:p.Leu175Ala L175A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q7RSF0:p.Phe198Ala F198A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q7RSF0:p.Trp171Ala W171A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q7RSF0:p.[Glu200Ala;Asp201Ala] E200A/D201A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q7RSF0:p.Glu179Ala E179A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false myoa_playo-q7rsf0_playo-2 3142772 N/A 3142774 unspecified role unspecified role bait bait Region 803-817 Region 803-817 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q7RQ71:p.Leu804Ala L804A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q7RQ71:p.Val807Ala V807A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q7RQ71:p.Ile811Ala I811A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q7RQ71:p.Arg812Ala R812A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false Q7RQ71:p.Arg814Ala R814A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3142775 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false