DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ colbert-2006-1 in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Colbert CL., Wu Q., Erbel PJ., Gardner KH., Deisenhofer J. DIP original experiment: DIP-262700X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Mechanism of substrate specificity in Bacillus subtilis ResA, a thioredoxin-like protein involved in cytochrome c maturation. Colbert CL., Wu Q., Erbel PJ., Gardner KH., Deisenhofer J. Only protein-protein interactions imex curation colbert-2006-2 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Colbert CL., Wu Q., Erbel PJ., Gardner KH., Deisenhofer J. DIP original experiment: DIP-262701X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Mechanism of substrate specificity in Bacillus subtilis ResA, a thioredoxin-like protein involved in cytochrome c maturation. Colbert CL., Wu Q., Erbel PJ., Gardner KH., Deisenhofer J. Only protein-protein interactions imex curation resa_bacsu Thiol-disulfide oxidoreductase ResA resA ypxA BSU23150 protein protein bacsu Bacillus subtilis MKKKRRLFIRTGILLVLICALGYTIYNAVFAGKESISEGSDAPNFVLEDTNGKRIELSDLKGKGVFLNFWGTWCEPCKKEFPYMANQYKHFKSQGVEIVAVNVGESKIAVHNFMKSYGVNFPVVLDTDRQVLDAYDVSPLPTTFLINPEGKVVKVVTGTMTESMIHDYMNLIKPGETSG c550_bacsu Cytochrome c-550 cccA Cytochrome c A BSU25190 protein protein bacsu Bacillus subtilis MKWNPLIPFLLIAVLGIGLTFFLSVKGLDDSREIASGGESKSAEKKDANASPEEIYKANCIACHGENYEGVSGPSLKGVGDKKDVAEIKTKIEKGGNGMPSGLVPADKLDDMAEWVSKIK ccca-resa-1 3142311 N/A 3142313 unspecified role unspecified role unspecified role unspecified role Region 37-179 Region 37-179 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3142314 unspecified role unspecified role unspecified role unspecified role Region 53-73 Region 53-73 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false ccca-resa-2 3142312 N/A 3142313 unspecified role unspecified role unspecified role unspecified role Region 37-179 Region 37-179 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3142314 unspecified role unspecified role unspecified role unspecified role Region 53-73 Region 53-73 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false