DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ nitta-2006-1 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. DIP original experiment: DIP-66423X PLoS biology 2006 IMEx IAN family critically regulates survival and development of T lymphocytes. Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. Only protein-protein interactions imex curation nitta-2006-2 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. DIP original experiment: DIP-66424X PLoS biology 2006 IMEx IAN family critically regulates survival and development of T lymphocytes. Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. Only protein-protein interactions imex curation nitta-2006-3 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. DIP original experiment: DIP-66425X PLoS biology 2006 IMEx IAN family critically regulates survival and development of T lymphocytes. Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. Only protein-protein interactions imex curation nitta-2006-4 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. DIP original experiment: DIP-66426X PLoS biology 2006 IMEx IAN family critically regulates survival and development of T lymphocytes. Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. Only protein-protein interactions imex curation nitta-2006-5 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. DIP original experiment: DIP-66427X PLoS biology 2006 IMEx IAN family critically regulates survival and development of T lymphocytes. Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. Only protein-protein interactions imex curation nitta-2006-6 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. DIP original experiment: DIP-66428X PLoS biology 2006 IMEx IAN family critically regulates survival and development of T lymphocytes. Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. Only protein-protein interactions imex curation nitta-2006-7 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. DIP original experiment: DIP-66429X PLoS biology 2006 IMEx IAN family critically regulates survival and development of T lymphocytes. Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. Only protein-protein interactions imex curation nitta-2006-8 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. DIP original experiment: DIP-66430X PLoS biology 2006 IMEx IAN family critically regulates survival and development of T lymphocytes. Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. Only protein-protein interactions imex curation nitta-2006-9 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. DIP original experiment: DIP-66431X PLoS biology 2006 IMEx IAN family critically regulates survival and development of T lymphocytes. Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. Only protein-protein interactions imex curation nitta-2006-10 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. DIP original experiment: DIP-66432X PLoS biology 2006 IMEx IAN family critically regulates survival and development of T lymphocytes. Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. Only protein-protein interactions imex curation nitta-2006-11 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. DIP original experiment: DIP-66433X PLoS biology 2006 IMEx IAN family critically regulates survival and development of T lymphocytes. Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. Only protein-protein interactions imex curation nitta-2006-12 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. DIP original experiment: DIP-66434X PLoS biology 2006 IMEx IAN family critically regulates survival and development of T lymphocytes. Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. Only protein-protein interactions imex curation nitta-2006-13 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. DIP original experiment: DIP-66435X PLoS biology 2006 IMEx IAN family critically regulates survival and development of T lymphocytes. Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. Only protein-protein interactions imex curation nitta-2006-14 mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. DIP original experiment: DIP-66436X PLoS biology 2006 IMEx IAN family critically regulates survival and development of T lymphocytes. Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. Only protein-protein interactions imex curation nitta-2006-15 mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. DIP original experiment: DIP-66437X PLoS biology 2006 IMEx IAN family critically regulates survival and development of T lymphocytes. Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. Only protein-protein interactions imex curation nitta-2006-16 mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. DIP original experiment: DIP-66438X PLoS biology 2006 IMEx IAN family critically regulates survival and development of T lymphocytes. Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. Only protein-protein interactions imex curation nitta-2006-17 mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. DIP original experiment: DIP-66439X PLoS biology 2006 IMEx IAN family critically regulates survival and development of T lymphocytes. Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. Only protein-protein interactions imex curation nitta-2006-18 mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. DIP original experiment: DIP-66440X PLoS biology 2006 IMEx IAN family critically regulates survival and development of T lymphocytes. Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. Only protein-protein interactions imex curation nitta-2006-19 mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. DIP original experiment: DIP-66441X PLoS biology 2006 IMEx IAN family critically regulates survival and development of T lymphocytes. Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. Only protein-protein interactions imex curation nitta-2006-20 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. DIP original experiment: DIP-66442X PLoS biology 2006 IMEx IAN family critically regulates survival and development of T lymphocytes. Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. Only protein-protein interactions imex curation nitta-2006-21 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. DIP original experiment: DIP-66443X PLoS biology 2006 IMEx IAN family critically regulates survival and development of T lymphocytes. Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. Only protein-protein interactions imex curation nitta-2006-22 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. DIP original experiment: DIP-66444X PLoS biology 2006 IMEx IAN family critically regulates survival and development of T lymphocytes. Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. Only protein-protein interactions imex curation nitta-2006-23 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. DIP original experiment: DIP-66445X PLoS biology 2006 IMEx IAN family critically regulates survival and development of T lymphocytes. Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. Only protein-protein interactions imex curation nitta-2006-24 mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. DIP original experiment: DIP-66446X PLoS biology 2006 IMEx IAN family critically regulates survival and development of T lymphocytes. Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. Only protein-protein interactions imex curation gima3_mouse GTPase IMAP family member 3 Gimap3 Ian4 Immunity-associated nucleotide 4 protein protein protein mouse Mus musculus Mouse METLQNVVTGGKKGGCTSGSRPLRILLVGKSGCGKSATGNSLLRRPAFESRLRGQSVTRTSQAETGTWEGRSILVVDTPPIFESKAQNQDMDKDIGDCYLLCAPGPHVLLLVTQLGRFTAEDVMAVRMVKEVFGVGVMRHMIVLFTRKEDLAEKSLEEFVTHTDNRSLRSLVQECGRRYCAFNNRASGEEQQGQLAELMALVRRLEQECEGSFHSNDLFLHAETLLREGYSVHQEAYRCYLAKVRQEVEKQRWELEEQEGSWVLKVLPIGKKLEVLHSDFCWYLVLAILIFFVFFFLLFYV bcl2_mouse Apoptosis regulator Bcl-2 Bcl2 Bcl-2 protein protein mouse Mus musculus Mouse MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK gima5_mouse GTPase IMAP family member 5 Gimap5 Ian4l1 Imap3 Immunity-associated nucleotide 4-like 1 protein Immunity-associated protein 3 GTPase of the immunity-associated protein 5 Ian5 protein protein mouse Mus musculus Mouse MEHLQKSTYGTIVQGPEAHCVQESSCLRILLVGKSGCGKSATGNSILRRPAFQSRLRGQSVTRTSQAETGTWEGRSILVVDTPPIFESKAQNQDMDKDIGDCYLLCAPGPHVLLLVTQLGRFTAEDAMAVRMVKEVFGVGVMRHMIVLFTRKEDLEEKSLEEFVTHTDNRSLRSLTQECGRRYCAFNNRASGEEQQGQLAELMALVRRLEQECEGSFHSNDLFLHAEALLREGYSVHQEAYRCYLAKVRQEVEKQRRELEEQEGSWIAKMICTVKSCWSSHTAACALLIVLGLTLLTTFINLCISRCK q07817-1 Bcl-2-like protein 1 BCLX Apoptosis regulator Bcl-X BCL2L1 BCL2L Bcl-xL protein protein human Homo sapiens Human MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK bax_human Apoptosis regulator BAX BAX BCL2L4 Bcl-2-like protein 4 protein protein human Homo sapiens Human MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG gima4_mouse GTPase IMAP family member 4 Gimap4 Ian1 Imap4 Immunity-associated protein 4 Immunity-associated nucleotide 1 protein protein protein mouse Mus musculus Mouse MEVQCGGAGFIPESSRSSHELGNQDQGIPQLRIVLLGKTGAGKSSTGNSILGEKVFNSGICAKSITKVCEKRVSTWDGKELVVVDTPGIFDTEVPDADTQREITRYVALTSPGPHALLLVVPLGRYTVEEHKATQKILDMFGKQARRFMILLLTRKDDLEDTDIHEYLEKAPKFFQEVMHEFQNRYCLFNNRASGAEKEEQKMQLLTLVQSMVRENGGRCFTNKMYESAECVIQKETLRMQELYREELEREKARIRREYEEQIKDLRDELEREIRRARMEREFKEREAIFTKNQQNARKEVENTSMILELIIKAWEIASFIFNQFMKD mint Exhibits intrisinic GTPase activity. Shows a higher affinity for GDP over GTP (about 12-fold higher), and binding shows an absolute requirement for magnesium bak_human Bcl-2 homologous antagonist/killer Apoptosis regulator BAK Bcl-2-like protein 7 BAK1 BAK BCL2L7 CDN1 protein protein human Homo sapiens Human MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS bad_human Bcl2-associated agonist of cell death Bcl-2-binding component 6 Bcl-2-like protein 8 BAD BBC6 BCL2L8 Bcl-xL/Bcl-2-associated death promoter Bcl2 antagonist of cell death protein protein human Homo sapiens Human MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ b2l11_human Bcl-2-like protein 11 BCL2L11 BIM Bcl2-interacting mediator of cell death protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH gimap3-bcl2-1 3141967 N/A 3141991 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3141992 unspecified role unspecified role prey prey human Homo sapiens Human direct interaction direct interaction false false false gimap5-bcl2-1 3141968 N/A 3141993 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3141992 unspecified role unspecified role prey prey human Homo sapiens Human direct interaction direct interaction false false false gimap3-bcl2l1-1 3141969 N/A 3141994 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3141991 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human direct interaction direct interaction false false false gimap5-bcl2l1-1 3141970 N/A 3141994 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3141993 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human direct interaction direct interaction false false false gimap3-bax-1 3141971 N/A 3141995 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3141991 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human direct interaction direct interaction false false false gimap5-bax-1 3141972 N/A 3141995 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3141993 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human direct interaction direct interaction false false false ian1-bax-1 3141973 n/a 3141996 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3141995 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human direct interaction direct interaction false false false gimap3-bak1-1 3141974 N/A 3141997 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3141991 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human direct interaction direct interaction false false false gimap5-bak1-1 3141975 N/A 3141997 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3141993 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human direct interaction direct interaction false false false gimap3-bad-1 3141976 N/A 3141998 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3141991 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human direct interaction direct interaction false false false gimap5-bad-1 3141977 N/A 3141998 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3141993 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human direct interaction direct interaction false false false gimap3-bcl2l11-1 3141978 N/A 3141999 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3141991 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human direct interaction direct interaction false false false gimap5-bcl2l11-1 3141979 N/A 3141999 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3141993 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human direct interaction direct interaction false false false gimap3-bcl2-2 3141980 N/A 3141991 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mouse Mus musculus Mouse N/A 3141992 unspecified role unspecified role prey prey mouse Mus musculus Mouse direct interaction direct interaction false false false gimap5-bcl2-2 3141981 N/A 3141993 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mouse Mus musculus Mouse N/A 3141992 unspecified role unspecified role prey prey mouse Mus musculus Mouse direct interaction direct interaction false false false gimap3-bcl2l1-2 3141982 N/A 3141994 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3141991 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mouse Mus musculus Mouse direct interaction direct interaction false false false gimap5-bcl2l1-2 3141983 N/A 3141994 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3141993 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mouse Mus musculus Mouse direct interaction direct interaction false false false gimap3-bax-2 3141984 N/A 3141995 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3141991 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mouse Mus musculus Mouse direct interaction direct interaction false false false gimap5-bax-2 3141985 N/A 3141995 unspecified role unspecified role prey prey mouse Mus musculus Mouse N/A 3141993 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human direct interaction direct interaction false false false bcl2-gimap3-1 3141986 N/A 3141991 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mouse Mus musculus Mouse N/A 3141992 unspecified role unspecified role bait bait mouse Mus musculus Mouse direct interaction direct interaction false false false bcl2-gimap5-1 3141987 N/A 3141993 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mouse Mus musculus Mouse N/A 3141992 unspecified role unspecified role bait bait mouse Mus musculus Mouse direct interaction direct interaction false false false bcl2l1-gimap3-1 3141988 N/A 3141994 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3141991 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mouse Mus musculus Mouse direct interaction direct interaction false false false bcl2l1-gimap5-1 3141989 N/A 3141994 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3141993 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mouse Mus musculus Mouse direct interaction direct interaction false false false gimap3-bcl2-3 3141990 N/A 3141991 unspecified role unspecified role bait bait mouse Mus musculus Mouse N/A 3141992 unspecified role unspecified role prey prey mouse Mus musculus Mouse direct interaction direct interaction false false false