DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ walther-2006-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip fingerprinting peptide massfingerprinting fingerprinting Walther TC., Brickner JH., Aguilar PS., Bernales S., Pantoja C., Walter P. DIP original experiment: DIP-253736X Nature 2006 IMEx Eisosomes mark static sites of endocytosis. Walther TC., Brickner JH., Aguilar PS., Bernales S., Pantoja C., Walter P. Only protein-protein interactions imex curation walther-2006-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip fingerprinting peptide massfingerprinting fingerprinting Walther TC., Brickner JH., Aguilar PS., Bernales S., Pantoja C., Walter P. DIP original experiment: DIP-253737X Nature 2006 IMEx Eisosomes mark static sites of endocytosis. Walther TC., Brickner JH., Aguilar PS., Bernales S., Pantoja C., Walter P. Only protein-protein interactions imex curation lsp1_yeast Sphingolipid long chain base-responsive protein LSP1 LSP1 YPL004C protein protein yeast Saccharomyces cerevisiae Baker's yeast MHRTYSLRNQRAPTAAELQAPPPPPSSTKSKFFGKASIASSFRKNAAGNFGPELARKLSQLVKTEKGVLRAMEVVASERREAAKQLSLWGADNDDDVSDVTDKLGVLIYELGELQDQFIDKYDQYRVTLKSIRNIEASVQPSRDRKEKITDEIAHLKYKDPQSTKIPVLEQELVRAEAESLVAEAQLSNITREKLKAAYSYMFDSLRELSEKFALIAGYGKALLELLDDSPVTPGEARPAYDGYEASRQIIMDAESALESWTLDMAAVKPTLSFHQTVDDVYEDEDGEEEEEPEIQNGDIPGQVVEEEEVEWTTEVPVDDEAHEADHHVSQNGHTSGSENI 6FCEE022ECC9778C pil1_yeast Sphingolipid long chain base-responsive protein PIL1 YGR086C PIL1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MHRTYSLRNSRAPTASQLQNPPPPPSTTKGRFFGKGGLAYSFRRSAAGAFGPELSRKLSQLVKIEKNVLRSMELTANERRDAAKQLSIWGLENDDDVSDITDKLGVLIYEVSELDDQFIDRYDQYRLTLKSIRDIEGSVQPSRDRKDKITDKIAYLKYKDPQSPKIEVLEQELVRAEAESLVAEAQLSNITRSKLRAAFNYQFDSIIEHSEKIALIAGYGKALLELLDDSPVTPGETRPAYDGYEASKQIIIDAESALNEWTLDSAQVKPTLSFKQDYEDFEPEEGEEEEEEDGQGRWSEDEQEDGQIEEPEQEEEGAVEEHEQVGHQQSESLPQQTTA C86AE5ABB508EA03 pil1-lsp1-21 3141876 N/A 3141878 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3141879 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false lsp1-pil1-21 3141877 N/A 3141878 unspecified role unspecified role bait bait Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3141879 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false