DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ novick-2006-1 in vitro In vitro pull down pull down de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Novick D., Rubinstein M., Azam T., Rabinkov A., Dinarello CA., Kim SH. DIP original experiment: DIP-262638X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Proteinase 3 is an IL-32 binding protein. Novick D., Rubinstein M., Azam T., Rabinkov A., Dinarello CA., Kim SH. Only protein-protein interactions imex curation novick-2006-2 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Novick D., Rubinstein M., Azam T., Rabinkov A., Dinarello CA., Kim SH. DIP original experiment: DIP-262639X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Proteinase 3 is an IL-32 binding protein. Novick D., Rubinstein M., Azam T., Rabinkov A., Dinarello CA., Kim SH. Only protein-protein interactions imex curation novick-2006-3 in vitro In vitro protease assay protease assay predetermined predetermined participant predetermined Novick D., Rubinstein M., Azam T., Rabinkov A., Dinarello CA., Kim SH. DIP original experiment: DIP-262640X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Proteinase 3 is an IL-32 binding protein. Novick D., Rubinstein M., Azam T., Rabinkov A., Dinarello CA., Kim SH. Only protein-protein interactions imex curation prtn3_human Myeloblastin MBN PRTN3 Leukocyte proteinase 3 AGP7 Wegener autoantigen P29 C-ANCA antigen Neutrophil proteinase 4 protein protein human Homo sapiens Human MAHRPPSPALASVLLALLLSGAARAAEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLRRVEAKGRP p24001-4 Interleukin-32 IL32 NK4 TAIF Natural killer cells protein 4 Tumor necrosis factor alpha-inducing factor Alpha protein protein human Homo sapiens Human MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKSYGAPRGDKEELTPQKCSEPQSSK il32-prtn3-1 3141776 N/A 3141779 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3141780 unspecified role unspecified role bait bait ecolx Escherichia coli physical association physical association false false false il32-prtn3-2 3141777 N/A 3141779 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3141780 unspecified role unspecified role bait bait ecolx Escherichia coli direct interaction direct interaction false false false il32-prtn3-3 3141778 N/A 3141779 enzyme enzyme unspecified role unspecified role human Homo sapiens Human N/A 3141780 enzyme target enzyme target substrate substrate unspecified role unspecified role 125I-label 125I-label 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli protein cleavage protein cleavage false false false