DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ zhuang-2006-1 in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Zhuang Z., Yoder BL., Burgers PM., Benkovic SJ. DIP original experiment: DIP-262584X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The structure of a ring-opened proliferating cell nuclear antigen-replication factor C complex revealed by fluorescence energy transfer. Zhuang Z., Yoder BL., Burgers PM., Benkovic SJ. Only protein-protein interactions imex curation zhuang-2006-2 ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Zhuang Z., Yoder BL., Burgers PM., Benkovic SJ. DIP original experiment: DIP-262585X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The structure of a ring-opened proliferating cell nuclear antigen-replication factor C complex revealed by fluorescence energy transfer. Zhuang Z., Yoder BL., Burgers PM., Benkovic SJ. Only protein-protein interactions imex curation pcna_yeast Proliferating cell nuclear antigen YBR0811 YBR088C POL30 protein protein yeast Saccharomyces cerevisiae Baker's yeast MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDIDADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINIMITKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPKFNDEE 9B56C5851621DDDC pcna-9 3141529 N/A 3141531 unspecified role unspecified role fluorescence donor fluorescence donor P15873:p.Phe185Trp F185W mutation mutation certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3141531 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept IAEDANS-label IAEDANS-label iaedans label iaedans label IAEDANS 1,5-IAEDANS (5((((2-iodoacetyl)amino)ethyl)amino)-naphthalene-1-sulfonic acid) IAEDANS 1,5-IAEDANS certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false pcna-10 3141530 N/A 3141531 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false