DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ burd-2006-1 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Burd CJ., Petre CE., Morey LM., Wang Y., Revelo MP., Haiman CA., Lu S., Fenoglio-Preiser CM., Li J., Knudsen ES., Wong J., Knudsen KE. DIP original experiment: DIP-262567X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Cyclin D1b variant influences prostate cancer growth through aberrant androgen receptor regulation. Burd CJ., Petre CE., Morey LM., Wang Y., Revelo MP., Haiman CA., Lu S., Fenoglio-Preiser CM., Li J., Knudsen ES., Wong J., Knudsen KE. Only protein-protein interactions imex curation burd-2006-2 chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Burd CJ., Petre CE., Morey LM., Wang Y., Revelo MP., Haiman CA., Lu S., Fenoglio-Preiser CM., Li J., Knudsen ES., Wong J., Knudsen KE. DIP original experiment: DIP-262570X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Cyclin D1b variant influences prostate cancer growth through aberrant androgen receptor regulation. Burd CJ., Petre CE., Morey LM., Wang Y., Revelo MP., Haiman CA., Lu S., Fenoglio-Preiser CM., Li J., Knudsen ES., Wong J., Knudsen KE. Only protein-protein interactions imex curation burd-2006-3 in vitro In vitro pull down pull down autoradiography autoradiography Burd CJ., Petre CE., Morey LM., Wang Y., Revelo MP., Haiman CA., Lu S., Fenoglio-Preiser CM., Li J., Knudsen ES., Wong J., Knudsen KE. DIP original experiment: DIP-262573X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Cyclin D1b variant influences prostate cancer growth through aberrant androgen receptor regulation. Burd CJ., Petre CE., Morey LM., Wang Y., Revelo MP., Haiman CA., Lu S., Fenoglio-Preiser CM., Li J., Knudsen ES., Wong J., Knudsen KE. Only protein-protein interactions imex curation burd-2006-4 chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Burd CJ., Petre CE., Morey LM., Wang Y., Revelo MP., Haiman CA., Lu S., Fenoglio-Preiser CM., Li J., Knudsen ES., Wong J., Knudsen KE. DIP original experiment: DIP-262568X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Cyclin D1b variant influences prostate cancer growth through aberrant androgen receptor regulation. Burd CJ., Petre CE., Morey LM., Wang Y., Revelo MP., Haiman CA., Lu S., Fenoglio-Preiser CM., Li J., Knudsen ES., Wong J., Knudsen KE. Only protein-protein interactions imex curation burd-2006-5 chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Burd CJ., Petre CE., Morey LM., Wang Y., Revelo MP., Haiman CA., Lu S., Fenoglio-Preiser CM., Li J., Knudsen ES., Wong J., Knudsen KE. DIP original experiment: DIP-262571X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Cyclin D1b variant influences prostate cancer growth through aberrant androgen receptor regulation. Burd CJ., Petre CE., Morey LM., Wang Y., Revelo MP., Haiman CA., Lu S., Fenoglio-Preiser CM., Li J., Knudsen ES., Wong J., Knudsen KE. Only protein-protein interactions imex curation burd-2006-6 chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Burd CJ., Petre CE., Morey LM., Wang Y., Revelo MP., Haiman CA., Lu S., Fenoglio-Preiser CM., Li J., Knudsen ES., Wong J., Knudsen KE. DIP original experiment: DIP-262569X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Cyclin D1b variant influences prostate cancer growth through aberrant androgen receptor regulation. Burd CJ., Petre CE., Morey LM., Wang Y., Revelo MP., Haiman CA., Lu S., Fenoglio-Preiser CM., Li J., Knudsen ES., Wong J., Knudsen KE. Only protein-protein interactions imex curation burd-2006-7 in vitro In vitro pull down pull down autoradiography autoradiography Burd CJ., Petre CE., Morey LM., Wang Y., Revelo MP., Haiman CA., Lu S., Fenoglio-Preiser CM., Li J., Knudsen ES., Wong J., Knudsen KE. DIP original experiment: DIP-262572X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Cyclin D1b variant influences prostate cancer growth through aberrant androgen receptor regulation. Burd CJ., Petre CE., Morey LM., Wang Y., Revelo MP., Haiman CA., Lu S., Fenoglio-Preiser CM., Li J., Knudsen ES., Wong J., Knudsen KE. Only protein-protein interactions imex curation ccnd1_human G1/S-specific cyclin-D1 CCND1 BCL1 PRAD1 PRAD1 oncogene BCL-1 oncogene B-cell lymphoma 1 protein protein protein human Homo sapiens Human MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIVATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI andr_human Androgen receptor Dihydrotestosterone receptor Nuclear receptor subfamily 3 group C member 4 AR DHTR NR3C4 protein protein human Homo sapiens Human MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREVIQNPGPRHPEAASAAPPGASLLLLQQQQQQQQQQQQQQQQQQQQQQQETSPRQQQQQQGEDGSPQAHRRGPTGYLVLDEEQQPSQPQSALECHPERGCVPEPGAAVAASKGLPQQLPAPPDEDDSAAPSTLSLLGPTFPGLSSCSADLKDILSEASTMQLLQQQQQEAVSEGSSSGRAREASGAPTSSKDNYLGGTSTISDNAKELCKAVSVSMGLGVEALEHLSPGEQLRGDCMYAPLLGVPPAVRPTPCAPLAECKGSLLDDSAGKSTEDTAEYSPFKGGYTKGLEGESLGCSGSAAAGSSGTLELPSTLSLYKSGALDEAAAYQSRDYYNFPLALAGPPPPPPPPHPHARIKLENPLDYGSAWAAAAAQCRYGDLASLHGAGAAGPGSGSPSAAASSSWHTLFTAEEGQLYGPCGGGGGGGGGGGGGGGGGGGGGGGEAGAVAPYGYTRPPQGLAGQESDFTAPDVWYPGGMVSRVPYPSPTCVKSEMGPWMDSYSGPYGDMRLETARDHVLPIDYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTQ hdac3_human Histone deacetylase 3 HDAC3 RPD3-2 SMAP45 protein protein human Homo sapiens Human MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI ccnd1-ar-1 3141081 N/A 3141088 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3141089 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association false false false ccnd1-ar-2 3141082 N/A 3141089 unspecified role unspecified role prey prey chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey N/A 3141088 unspecified role unspecified role bait bait chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association false false false ccnd1-ar-3 3141083 N/A 3141089 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 3141088 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false ccnd1-hdac3-1 3141084 N/A 3141090 unspecified role unspecified role prey prey chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey N/A 3141088 unspecified role unspecified role bait bait chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association false false false ar-ccnd1-1 3141085 N/A 3141089 unspecified role unspecified role bait bait chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey N/A 3141088 unspecified role unspecified role prey prey chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association false false false hdac3-ccnd1-1 3141086 N/A 3141090 unspecified role unspecified role bait bait chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey N/A 3141088 unspecified role unspecified role prey prey chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association false false false ccnd1-hdac3-2 3141087 N/A 3141090 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 3141088 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false