DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ pazhouhandeh-2006-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Pazhouhandeh M., Dieterle M., Marrocco K., Lechner E., Berry B., Brault V., Hemmer O., Kretsch T., Richards KE., Genschik P., Ziegler-Graff V. DIP original experiment: DIP-262934X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx F-box-like domain in the polerovirus protein P0 is required for silencing suppressor function. Pazhouhandeh M., Dieterle M., Marrocco K., Lechner E., Berry B., Brault V., Hemmer O., Kretsch T., Richards KE., Genschik P., Ziegler-Graff V. Only protein-protein interactions imex curation pazhouhandeh-2006-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Pazhouhandeh M., Dieterle M., Marrocco K., Lechner E., Berry B., Brault V., Hemmer O., Kretsch T., Richards KE., Genschik P., Ziegler-Graff V. DIP original experiment: DIP-262937X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx F-box-like domain in the polerovirus protein P0 is required for silencing suppressor function. Pazhouhandeh M., Dieterle M., Marrocco K., Lechner E., Berry B., Brault V., Hemmer O., Kretsch T., Richards KE., Genschik P., Ziegler-Graff V. Only protein-protein interactions imex curation pazhouhandeh-2006-3 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Pazhouhandeh M., Dieterle M., Marrocco K., Lechner E., Berry B., Brault V., Hemmer O., Kretsch T., Richards KE., Genschik P., Ziegler-Graff V. DIP original experiment: DIP-262940X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx F-box-like domain in the polerovirus protein P0 is required for silencing suppressor function. Pazhouhandeh M., Dieterle M., Marrocco K., Lechner E., Berry B., Brault V., Hemmer O., Kretsch T., Richards KE., Genschik P., Ziegler-Graff V. Only protein-protein interactions imex curation pazhouhandeh-2006-4 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Pazhouhandeh M., Dieterle M., Marrocco K., Lechner E., Berry B., Brault V., Hemmer O., Kretsch T., Richards KE., Genschik P., Ziegler-Graff V. DIP original experiment: DIP-262935X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx F-box-like domain in the polerovirus protein P0 is required for silencing suppressor function. Pazhouhandeh M., Dieterle M., Marrocco K., Lechner E., Berry B., Brault V., Hemmer O., Kretsch T., Richards KE., Genschik P., Ziegler-Graff V. Only protein-protein interactions imex curation pazhouhandeh-2006-5 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Pazhouhandeh M., Dieterle M., Marrocco K., Lechner E., Berry B., Brault V., Hemmer O., Kretsch T., Richards KE., Genschik P., Ziegler-Graff V. DIP original experiment: DIP-262938X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx F-box-like domain in the polerovirus protein P0 is required for silencing suppressor function. Pazhouhandeh M., Dieterle M., Marrocco K., Lechner E., Berry B., Brault V., Hemmer O., Kretsch T., Richards KE., Genschik P., Ziegler-Graff V. Only protein-protein interactions imex curation pazhouhandeh-2006-6 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Pazhouhandeh M., Dieterle M., Marrocco K., Lechner E., Berry B., Brault V., Hemmer O., Kretsch T., Richards KE., Genschik P., Ziegler-Graff V. DIP original experiment: DIP-262936X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx F-box-like domain in the polerovirus protein P0 is required for silencing suppressor function. Pazhouhandeh M., Dieterle M., Marrocco K., Lechner E., Berry B., Brault V., Hemmer O., Kretsch T., Richards KE., Genschik P., Ziegler-Graff V. Only protein-protein interactions imex curation pazhouhandeh-2006-7 sinal Sinapis alba (White mustard) Brassica hirta White mustard bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Pazhouhandeh M., Dieterle M., Marrocco K., Lechner E., Berry B., Brault V., Hemmer O., Kretsch T., Richards KE., Genschik P., Ziegler-Graff V. DIP original experiment: DIP-262941X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx F-box-like domain in the polerovirus protein P0 is required for silencing suppressor function. Pazhouhandeh M., Dieterle M., Marrocco K., Lechner E., Berry B., Brault V., Hemmer O., Kretsch T., Richards KE., Genschik P., Ziegler-Graff V. Only protein-protein interactions imex curation pazhouhandeh-2006-8 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Pazhouhandeh M., Dieterle M., Marrocco K., Lechner E., Berry B., Brault V., Hemmer O., Kretsch T., Richards KE., Genschik P., Ziegler-Graff V. DIP original experiment: DIP-262939X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx F-box-like domain in the polerovirus protein P0 is required for silencing suppressor function. Pazhouhandeh M., Dieterle M., Marrocco K., Lechner E., Berry B., Brault V., Hemmer O., Kretsch T., Richards KE., Genschik P., Ziegler-Graff V. Only protein-protein interactions imex curation q65967_9viru protein protein cucap Cucurbit aphid-borne yellows virus MQIESVKQQLIFRPTRRTSINDRKLNVANFLINHSFFLAINGTNLLRLFLARLPLLISEQLSGDYVYTPGASKRIILARFHRHCGAPLPSSSAVDLRLPASKDVARFFLARHYSRALGERIQRNQTSLFRGYAEFAKFINVWCSSISHRLGEFTPRNFTNGSIFVDLSNLGHSLCDLVLAQQVHDRDAYTRLALHIHRIYGEDGGLDFWRLANFPSKSWPFNGERCLEGSVVQKELQR skp1b_arath SKP1-like protein 1B SKP1-like 2 UFO-binding protein 2 ASK2 UIP2 At5g42190 MJC20.30 SKP1B protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSTVRKITLKSSDGENFEIDEAVALESQTIKHMIEDDCTDNGIPLPNVTSKILSKVIEYCKRHVEAAEKSETTADAAAATTTTTVASGSSDEDLKTWDSEFIKVDQGTLFDLILAANYLNIKGLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE cul1_arath Cullin-1 CUL1 At4g02570 T10P11.26 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MERKTIDLEQGWDYMQTGITKLKRILEGLNEPAFDSEQYMMLYTTIYNMCTQKPPHDYSQQLYDKYREAFEEYINSTVLPALREKHDEFMLRELFKRWSNHKVMVRWLSRFFYYLDRYFIARRSLPPLNEVGLTCFRDLVYNELHSKVKQAVIALVDKEREGEQIDRALLKNVLDIYVEIGMGQMERYEEDFESFMLQDTSSYYSRKASSWIQEDSCPDYMLKSEECLKKERERVAHYLHSSSEPKLVEKVQHELLVVFASQLLEKEHSGCRALLRDDKVDDLSRMYRLYHKILRGLEPVANIFKQHVTAEGNALVQQAEDTATNQVANTASVQEQVLIRKVIELHDKYMVYVTECFQNHTLFHKALKEAFEIFCNKTVAGSSSAELLATFCDNILKKGGSEKLSDEAIEDTLEKVVKLLAYISDKDLFAEFYRKKLARRLLFDRSANDDHERSILTKLKQQCGGQFTSKMEGMVTDLTLARENQNSFEDYLGSNPAANPGIDLTVTVLTTGFWPSYKSFDINLPSEMIKCVEVFKGFYETKTKHRKLTWIYSLGTCHINGKFDQKAIELIVSTYQAAVLLLFNTTDKLSYTEILAQLNLSHEDLVRLLHSLSCAKYKILLKEPNTKTVSQNDAFEFNSKFTDRMRRIKIPLPPVDERKKVVEDVDKDRRYAIDAAIVRIMKSRKVLGHQQLVSECVEQLSRMFKPDIKAIKKRMEDLITRDYLERDKENPNMFRYLA q8jz12_9viru protein protein beewe Beet western yellows virus MLFETYNHILIFRANRFLTAGERILNTAEFLIAYLILFVKHDNANVNIFLARLPLLLSEQLQGDFRYVPGRRQRHRLARLHKACGASLHSSGAVNLRLPPTQDVAGLFLARNASRSMGERIHKHQDLLAKGKDEFDRFLSVWCADAERSLSQTSKVCAERDNVCVELINLGFALRALVLDPRVHCRSAYARVALCVYRIYGEDSGLDFWRLANFPLQCWPYHIEKHFTGSVVQKILQM skp1a_arath SKP1-like protein 1A UFO-binding protein 1 SKP1 UIP1 At1g75950 T4O12.17 SKP1A ASK1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSAKKIVLKSSDGESFEVEEAVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCKRHVEAAASKAEAVEGAATSDDDLKAWDADFMKIDQATLFELILAANYLNIKNLLDLTCQTVADMIKGKTPEEIRTTFNIKNDFTPEEEEEVRRENQWAFE q65967_9lute-skp1b-1 3140911 N/A 3140919 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3140920 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q65967_9lute-cul1-1 3140912 N/A 3140921 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3140919 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false skp1b-q65967_9lute-1 3140913 N/A 3140920 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3140919 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false q65967_9lute-skp1b-2 3140914 N/A 3140919 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3140920 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q8jz12_9lute-cul1-1 3140915 N/A 3140922 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3140921 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q65967_9lute-skp1a-1 3140916 N/A 3140923 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3140919 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false q65967_9lute-skp1a-2 3140917 N/A 3140923 unspecified role unspecified role unspecified role unspecified role cYFP-tag cYFP-tag cyfp cYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range false sinal Sinapis alba (White mustard) Brassica hirta White mustard N/A 3140919 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range false sinal Sinapis alba (White mustard) Brassica hirta White mustard physical association physical association false false false skp1a-q65967_9lute-1 3140918 N/A 3140923 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3140919 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false