DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ brautigam-2006-1 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Brautigam CA., Wynn RM., Chuang JL., Machius M., Tomchick DR., Chuang DT. DIP original experiment: DIP-66163X Structure (London, England : 1993) 2006 IMEx Structural insight into interactions between dihydrolipoamide dehydrogenase (E3) and E3 binding protein of human pyruvate dehydrogenase complex. Brautigam CA., Wynn RM., Chuang JL., Machius M., Tomchick DR., Chuang DT. Only protein-protein interactions imex curation brautigam-2006-2 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Brautigam CA., Wynn RM., Chuang JL., Machius M., Tomchick DR., Chuang DT. DIP original experiment: DIP-66162X Structure (London, England : 1993) 2006 IMEx Structural insight into interactions between dihydrolipoamide dehydrogenase (E3) and E3 binding protein of human pyruvate dehydrogenase complex. Brautigam CA., Wynn RM., Chuang JL., Machius M., Tomchick DR., Chuang DT. Only protein-protein interactions imex curation dldh_human Dihydrolipoyl dehydrogenase, mitochondrial DLD GCSL LAD PHE3 Dihydrolipoamide dehydrogenase Glycine cleavage system L protein protein protein human Homo sapiens Human MQSWSRVYCSLAKRGHFNRISHGLQGLSAVPLRTYADQPIDADVTVIGSGPGGYVAAIKAAQLGFKTVCIEKNETLGGTCLNVGCIPSKALLNNSHYYHMAHGKDFASRGIEMSEVRLNLDKMMEQKSTAVKALTGGIAHLFKQNKVVHVNGYGKITGKNQVTATKADGGTQVIDTKNILIATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKMVVIGAGVIGVELGSVWQRLGADVTAVEFLGHVGGVGIDMEISKNFQRILQKQGFKFKLNTKVTGATKKSDGKIDVSIEAASGGKAEVITCDVLLVCIGRRPFTKNLGLEELGIELDPRGRIPVNTRFQTKIPNIYAIGDVVAGPMLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVAWVGKSEEQLKEEGIEYKVGKFPFAANSRAKTNADTDGMVKILGQKSTDRVLGAHILGPGAGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF This sequence has been withdrawn from Uniprot. 7613492C516F3835 odpx_human Pyruvate dehydrogenase protein X component, mitochondrial Dihydrolipoamide dehydrogenase-binding protein of pyruvate dehydrogenase complex Lipoyl-containing pyruvate dehydrogenase complex component X E3-binding protein proX PDHX PDX1 protein protein human Homo sapiens Human MAASWRLGCDPRLLRYLVGFPGRRSVGLVKGALGWSVSRGANWRWFHSTQWLRGDPIKILMPSLSPTMEEGNIVKWLKKEGEAVSAGDALCEIETDKAVVTLDASDDGILAKIVVEEGSKNIRLGSLIGLIVEEGEDWKHVEIPKDVGPPPPVSKPSEPRPSPEPQISIPVKKEHIPGTLRFRLSPAARNILEKHSLDASQGTATGPRGIFTKEDALKLVQLKQTGKITESRPTPAPTATPTAPSPLQATAGPSYPRPVIPPVSTPGQPNAVGTFTEIPASNIRRVIAKRLTESKSTVPHAYATADCDLGAVLKVRQDLVKDDIKVSVNDFIIKAAAVTLKQMPDVNVSWDGEGPKQLPFIDISVAVATDKGLLTPIIKDAAAKGIQEIADSVKALSKKARDGKLLPEEYQGGSFSISNLGMFGIDEFTAVINPPQACILAVGRFRPVLKLTEDEEGNAKLQQRQLITVTMSSDSRVVDDELATRFLKSFKANLENPIRLA e3-pdhx-1 3140878 N/A 3140880 unspecified role unspecified role unspecified role unspecified role Region 36-509 Region 36-509 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3140881 unspecified role unspecified role unspecified role unspecified role Region 173-230 Region 173-230 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false e3-pdhx-2 3140879 N/A 3140880 unspecified role unspecified role unspecified role unspecified role Region 36-509 Region 36-509 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3140881 unspecified role unspecified role unspecified role unspecified role Region 173-230 Region 173-230 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false