DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ schellenberg-2006-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Schellenberg MJ., Edwards RA., Ritchie DB., Kent OA., Golas MM., Stark H., Lührmann R., Glover JN., MacMillan AM. DIP original experiment: DIP-262528X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Crystal structure of a core spliceosomal protein interface. Schellenberg MJ., Edwards RA., Ritchie DB., Kent OA., Golas MM., Stark H., Lührmann R., Glover JN., MacMillan AM. Only protein-protein interactions imex curation schellenberg-2006-2 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Schellenberg MJ., Edwards RA., Ritchie DB., Kent OA., Golas MM., Stark H., Lührmann R., Glover JN., MacMillan AM. DIP original experiment: DIP-262526X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Crystal structure of a core spliceosomal protein interface. Schellenberg MJ., Edwards RA., Ritchie DB., Kent OA., Golas MM., Stark H., Lührmann R., Glover JN., MacMillan AM. Only protein-protein interactions imex curation schellenberg-2006-3 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Schellenberg MJ., Edwards RA., Ritchie DB., Kent OA., Golas MM., Stark H., Lührmann R., Glover JN., MacMillan AM. DIP original experiment: DIP-262527X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Crystal structure of a core spliceosomal protein interface. Schellenberg MJ., Edwards RA., Ritchie DB., Kent OA., Golas MM., Stark H., Lührmann R., Glover JN., MacMillan AM. Only protein-protein interactions imex curation o75533-1 Splicing factor 3B subunit 1 SF3B1 SAP155 Pre-mRNA-splicing factor SF3b 155 kDa subunit Spliceosome-associated protein 155 protein protein human Homo sapiens Human MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSRFAGYVTSIAATELEDDDDDYSSSTSLLGQKKPGYHAPVALLNDIPQSTEQYDPFAEHRPPKIADREDEYKKHRRTMIISPERLDPFADGGKTPDPKMNARTYMDVMREQHLTKEEREIRQQLAEKAKAGELKVVNGAAASQPPSKRKRRWDQTADQTPGATPKKLSSWDQAETPGHTPSLRWDETPGRAKGSETPGATPGSKIWDPTPSHTPAGAATPGRGDTPGHATPGHGGATSSARKNRWDETPKTERDTPGHGSGWAETPRTDRGGDSIGETPTPGASKRKSRWDETPASQMGGSTPVLTPGKTPIGTPAMNMATPTPGHIMSMTPEQLQAWRWEREIDERNRPLSDEELDAMFPEGYKVLPPPAGYVPIRTPARKLTATPTPLGGMTGFHMQTEDRTMKSVNDQPSGNLPFLKPDDIQYFDKLLVDVDESTLSPEEQKERKIMKLLLKIKNGTPPMRKAALRQITDKAREFGAGPLFNQILPLLMSPTLEDQERHLLVKVIDRILYKLDDLVRPYVHKILVVIEPLLIDEDYYARVEGREIISNLAKAAGLATMISTMRPDIDNMDEYVRNTTARAFAVVASALGIPSLLPFLKAVCKSKKSWQARHTGIKIVQQIAILMGCAILPHLRSLVEIIEHGLVDEQQKVRTISALAIAALAEAATPYGIESFDSVLKPLWKGIRQHRGKGLAAFLKAIGYLIPLMDAEYANYYTREVMLILIREFQSPDEEMKKIVLKVVKQCCGTDGVEANYIKTEILPPFFKHFWQHRMALDRRNYRQLVDTTVELANKVGAAEIISRIVDDLKDEAEQYRKMVMETIEKIMGNLGAADIDHKLEEQLIDGILYAFQEQTTEDSVMLNGFGTVVNALGKRVKPYLPQICGTVLWRLNNKSAKVRQQAADLISRTAVVMKTCQEEKLMGHLGVVLYEYLGEEYPEVLGSILGALKAIVNVIGMHKMTPPIKDLLPRLTPILKNRHEKVQENCIDLVGRIADRGAEYVSAREWMRICFELLELLKAHKKAIRRATVNTFGYIAKAIGPHDVLATLLNNLKVQERQNRVCTTVAIAIVAETCSPFTVLPALMNEYRVPELNVQNGVLKSLSFLFEYIGEMGKDYIYAVTPLLEDALMDRDLVHRQTASAVVQHMSLGVYGFGCEDSLNHLLNYVWPNVFETSPHVIQAVMGALEGLRVAIGPCRMLQYCLQGLFHPARKVRDVYWKIYNSIYIGSQDALIAHYPRIYNDDKNTYIRYELDYIL sf3b6_human Splicing factor 3B subunit 6 SF3B6 Pre-mRNA branch site protein p14 SAP14 SF3B14 SF3B14A SF3b 14 kDa subunit Spliceosome-associated protein, 14-kDa Splicing factor 3b, subunit 6, 14kDa CGI-110 HSPC175 HT006 protein protein human Homo sapiens Human MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK sf3b1-sf3b6-1 3140825 N/A 3140828 unspecified role unspecified role unspecified role unspecified role Region 381-415 Region 381-415 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3140829 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false sf3b1-sf3b6-2 3140826 N/A 3140828 unspecified role unspecified role unspecified role unspecified role Region 373-415 Region 373-415 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3140829 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false sf3b6-sf3b1-1 3140827 N/A 3140828 unspecified role unspecified role prey prey Region 373-415 Region 373-415 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3140829 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false