DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ buchanan-2006-1 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Buchanan FG., Gorden DL., Matta P., Shi Q., Matrisian LM., DuBois RN. DIP original experiment: DIP-262512X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Role of beta-arrestin 1 in the metastatic progression of colorectal cancer. Buchanan FG., Gorden DL., Matta P., Shi Q., Matrisian LM., DuBois RN. Only protein-protein interactions imex curation buchanan-2006-2 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Buchanan FG., Gorden DL., Matta P., Shi Q., Matrisian LM., DuBois RN. DIP original experiment: DIP-262515X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Role of beta-arrestin 1 in the metastatic progression of colorectal cancer. Buchanan FG., Gorden DL., Matta P., Shi Q., Matrisian LM., DuBois RN. Only protein-protein interactions imex curation buchanan-2006-3 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Buchanan FG., Gorden DL., Matta P., Shi Q., Matrisian LM., DuBois RN. DIP original experiment: DIP-262513X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Role of beta-arrestin 1 in the metastatic progression of colorectal cancer. Buchanan FG., Gorden DL., Matta P., Shi Q., Matrisian LM., DuBois RN. Only protein-protein interactions imex curation buchanan-2006-4 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Buchanan FG., Gorden DL., Matta P., Shi Q., Matrisian LM., DuBois RN. DIP original experiment: DIP-262514X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Role of beta-arrestin 1 in the metastatic progression of colorectal cancer. Buchanan FG., Gorden DL., Matta P., Shi Q., Matrisian LM., DuBois RN. Only protein-protein interactions imex curation src_human Proto-oncogene tyrosine-protein kinase Src pp60c-src SRC SRC1 Proto-oncogene c-Src protein protein human Homo sapiens Human MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL arrb1_human Beta-arrestin-1 Arrestin beta-1 ARRB1 ARR1 Non-visual arrestin-2 protein protein human Homo sapiens Human MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNR p49407-1 Beta-arrestin-1 ARRB1 ARR1 Arrestin beta-1 Non-visual arrestin-2 protein protein human Homo sapiens Human MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNR pe2r4_human Prostaglandin E2 receptor EP4 subtype PTGER4 PTGER2 Prostanoid EP4 receptor protein protein human Homo sapiens Human MSTPGVNSSASLSPDRLNSPVTIPAVMFIFGVVGNLVAIVVLCKSRKEQKETTFYTLVCGLAVTDLLGTLLVSPVTIATYMKGQWPGGQPLCEYSTFILLFFSLSGLSIICAMSVERYLAINHAYFYSHYVDKRLAGLTLFAVYASNVLFCALPNMGLGSSRLQYPDTWCFIDWTTNVTAHAAYSYMYAGFSSFLILATVLCNVLVCGALLRMHRQFMRRTSLGTEQHHAAAAASVASRGHPAASPALPRLSDFRRRRSFRRIAGAEIQMVILLIATSLVVLICSIPLVVRVFVNQLYQPSLEREVSKNPDLQAIRIASVNPILDPWIYILLRKTVLSKAIEKIKCLFCRIGGSRRERSGQHCSDSQRTSSAMSGHSRSFISRELKEISSTSQTLLPDLSLPDLSENGLGGRNLLPGVPGMGLAQEDTTSLRTLRISETSDSSQGQDSESVLLVDEAGGSGRAGPAPKGSSLQVTFPSETLNLSEKCI arrb1-src-1 3140725 N/A 3140729 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3140730 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false src-arrb1-1 3140726 N/A 3140731 unspecified role unspecified role prey prey P49407-1:p.Ser412Asp S412D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human N/A 3140729 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false src-ptger4-1 3140727 N/A 3140732 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3140729 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association false false false arrb1-ptger4-1 3140728 N/A 3140732 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3140729 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3140730 unspecified role unspecified role bait bait human Homo sapiens Human association association false false false