DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ stagg-2006-1 trini Trichoplusia ni (Cabbage looper) Cabbage looper 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Stagg SM., Gürkan C., Fowler DM., LaPointe P., Foss TR., Potter CS., Carragher B., Balch WE. DIP original experiment: DIP-253761X Nature 2006 IMEx Structure of the Sec13/31 COPII coat cage. Stagg SM., Gürkan C., Fowler DM., LaPointe P., Foss TR., Potter CS., Carragher B., Balch WE. Only protein-protein interactions imex curation stagg-2006-2 trini Trichoplusia ni (Cabbage looper) Cabbage looper solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Stagg SM., Gürkan C., Fowler DM., LaPointe P., Foss TR., Potter CS., Carragher B., Balch WE. DIP original experiment: DIP-253766X Nature 2006 IMEx Structure of the Sec13/31 COPII coat cage. Stagg SM., Gürkan C., Fowler DM., LaPointe P., Foss TR., Potter CS., Carragher B., Balch WE. Only protein-protein interactions imex curation stagg-2006-3 trini Trichoplusia ni (Cabbage looper) Cabbage looper ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Stagg SM., Gürkan C., Fowler DM., LaPointe P., Foss TR., Potter CS., Carragher B., Balch WE. DIP original experiment: DIP-253764X Nature 2006 IMEx Structure of the Sec13/31 COPII coat cage. Stagg SM., Gürkan C., Fowler DM., LaPointe P., Foss TR., Potter CS., Carragher B., Balch WE. Only protein-protein interactions imex curation stagg-2006-4 trini Trichoplusia ni (Cabbage looper) Cabbage looper tem transmission electron microscopy tem predetermined predetermined participant predetermined Stagg SM., Gürkan C., Fowler DM., LaPointe P., Foss TR., Potter CS., Carragher B., Balch WE. DIP original experiment: DIP-253767X Nature 2006 IMEx Structure of the Sec13/31 COPII coat cage. Stagg SM., Gürkan C., Fowler DM., LaPointe P., Foss TR., Potter CS., Carragher B., Balch WE. Only protein-protein interactions imex curation stagg-2006-5 trini Trichoplusia ni (Cabbage looper) Cabbage looper molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Stagg SM., Gürkan C., Fowler DM., LaPointe P., Foss TR., Potter CS., Carragher B., Balch WE. DIP original experiment: DIP-253762X Nature 2006 IMEx Structure of the Sec13/31 COPII coat cage. Stagg SM., Gürkan C., Fowler DM., LaPointe P., Foss TR., Potter CS., Carragher B., Balch WE. Only protein-protein interactions imex curation stagg-2006-6 trini Trichoplusia ni (Cabbage looper) Cabbage looper pull down pull down predetermined predetermined participant predetermined Stagg SM., Gürkan C., Fowler DM., LaPointe P., Foss TR., Potter CS., Carragher B., Balch WE. DIP original experiment: DIP-253765X Nature 2006 IMEx Structure of the Sec13/31 COPII coat cage. Stagg SM., Gürkan C., Fowler DM., LaPointe P., Foss TR., Potter CS., Carragher B., Balch WE. Only protein-protein interactions imex curation stagg-2006-7 trini Trichoplusia ni (Cabbage looper) Cabbage looper dls dynamic light scattering dls predetermined predetermined participant predetermined Stagg SM., Gürkan C., Fowler DM., LaPointe P., Foss TR., Potter CS., Carragher B., Balch WE. DIP original experiment: DIP-253763X Nature 2006 IMEx Structure of the Sec13/31 COPII coat cage. Stagg SM., Gürkan C., Fowler DM., LaPointe P., Foss TR., Potter CS., Carragher B., Balch WE. Only protein-protein interactions imex curation stagg-2006-8 trini Trichoplusia ni (Cabbage looper) Cabbage looper light scattering light scattering predetermined predetermined participant predetermined Stagg SM., Gürkan C., Fowler DM., LaPointe P., Foss TR., Potter CS., Carragher B., Balch WE. DIP original experiment: DIP-253768X Nature 2006 IMEx Structure of the Sec13/31 COPII coat cage. Stagg SM., Gürkan C., Fowler DM., LaPointe P., Foss TR., Potter CS., Carragher B., Balch WE. Only protein-protein interactions imex curation o94979-1 Protein transport protein Sec31A SEC31A KIAA0905 SEC31L1 ABP125 ABP130 SEC31-like protein 1 SEC31-related protein A Web1-like protein HSPC275 HSPC334 protein protein human Homo sapiens Human MKLKEVDRTAMQAWSPAQNHPIYLATGTSAQQLDATFSTNASLEIFELDLSDPSLDMKSCATFSSSHRYHKLIWGPYKMDSKGDVSGVLIAGGENGNIILYDPSKIIAGDKEVVIAQNDKHTGPVRALDVNIFQTNLVASGANESEIYIWDLNNFATPMTPGAKTQPPEDISCIAWNRQVQHILASASPSGRATVWDLRKNEPIIKVSDHSNRMHCSGLAWHPDVATQMVLASEDDRLPVIQMWDLRFASSPLRVLENHARGILAIAWSMADPELLLSCGKDAKILCSNPNTGEVLYELPTNTQWCFDIQWCPRNPAVLSAASFDGRISVYSIMGGSTDGLRQKQVDKLSSSFGNLDPFGTGQPLPPLQIPQQTAQHSIVLPLKKPPKWIRRPVGASFSFGGKLVTFENVRMPSHQGAEQQQQQHHVFISQVVTEKEFLSRSDQLQQAVQSQGFINYCQKKIDASQTEFEKNVWSFLKVNFEDDSRGKYLELLGYRKEDLGKKIALALNKVDGANVALKDSDQVAQSDGEESPAAEEQLLGEHIKEEKEESEFLPSSGGTFNISVSGDIDGLITQALLTGNFESAVDLCLHDNRMADAIILAIAGGQELLARTQKKYFAKSQSKITRLITAVVMKNWKEIVESCDLKNWREALAAVLTYAKPDEFSALCDLLGTRLENEGDSLLQTQACLCYICAGNVEKLVACWTKAQDGSHPLSLQDLIEKVVILRKAVQLTQAMDTSTVGVLLAAKMSQYANLLAAQGSIAAALAFLPDNTNQPNIMQLRDRLCRAQGEPVAGHESPKIPYEKQQLPKGRPGPVAGHHQMPRVQTQQYYPHGENPPPPGFIMHGNVNPNAAGQLPTSPGHMHTQVPPYPQPQPYQPAQPYPFGTGGSAMYRPQQPVAPPTSNAYPNTPYISSASSYTGQSQLYAAQHQASSPTSSPATSFPPPPSSGASFQHGGPGAPPSSSAYALPPGTTGTLPAASELPASQRTGPQNGWNDPPALNRVPKKKKMPENFMPPVPITSPIMNPLGDPQSQMLQQQPSAPVPLSSQSSFPQPHLPGGQPFHGVQQPLGQTGMPPSFSKPNIEGAPGAPIGNTFQHVQSLPTKKITKKPIPDEHLILKTTFEDLIQRCLSSATDPQTKRKLDDASKRLEFLYDKLREQTLSPTITSGLHNIARSIETRNYSEGLTMHTHIVSTSNFSETSAFMPVLKVVLTQANKLGV p55735-1 Protein SEC13 homolog GATOR complex protein SEC13 SEC13 D3S1231E SEC13L1 SEC13R SEC13-like protein 1 SEC13-related protein SEC13A protein protein human Homo sapiens Human MVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQGSVSASVTEGQQNEQ sec13-sec31a-2 3140536 N/A 3140544 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3140545 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false sec13-sec31a-3 3140537 N/A 3140544 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3140545 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false sec13-sec31a-4 3140538 N/A 3140544 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3140545 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false sec13-sec31a-5 3140539 N/A 3140544 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3140545 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false sec13-sec31a-6 3140540 N/A 3140544 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3140545 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false sec13-sec31a-7 3140541 N/A 3140544 unspecified role unspecified role prey prey trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3140545 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false trini Trichoplusia ni (Cabbage looper) Cabbage looper physical association physical association false false false sec13-sec31a-8 3140542 N/A 3140544 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3140545 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false sec13-sec31a-9 3140543 N/A 3140544 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper N/A 3140545 unspecified role unspecified role unspecified role unspecified role trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction false false false