DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ bowman-2006-1 human Homo sapiens Human coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip western blot western blot Immuno blot Immuno blot Bowman BR., Moure CM., Kirtane BM., Welschhans RL., Tominaga K., Pereira-Smith OM., Quiocho FA. DIP original experiment: DIP-66119X Structure (London, England : 1993) 2006 IMEx Multipurpose MRG domain involved in cell senescence and proliferation exhibits structural homology to a DNA-interacting domain. Bowman BR., Moure CM., Kirtane BM., Welschhans RL., Tominaga K., Pereira-Smith OM., Quiocho FA. Only protein-protein interactions imex curation bowman-2006-2 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Bowman BR., Moure CM., Kirtane BM., Welschhans RL., Tominaga K., Pereira-Smith OM., Quiocho FA. DIP original experiment: DIP-66120X Structure (London, England : 1993) 2006 IMEx Multipurpose MRG domain involved in cell senescence and proliferation exhibits structural homology to a DNA-interacting domain. Bowman BR., Moure CM., Kirtane BM., Welschhans RL., Tominaga K., Pereira-Smith OM., Quiocho FA. Only protein-protein interactions imex curation bowman-2006-3 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Bowman BR., Moure CM., Kirtane BM., Welschhans RL., Tominaga K., Pereira-Smith OM., Quiocho FA. DIP original experiment: DIP-66118X Structure (London, England : 1993) 2006 IMEx Multipurpose MRG domain involved in cell senescence and proliferation exhibits structural homology to a DNA-interacting domain. Bowman BR., Moure CM., Kirtane BM., Welschhans RL., Tominaga K., Pereira-Smith OM., Quiocho FA. Only protein-protein interactions imex curation mr1l1_human MORF4 family-associated protein 1-like 1 PP784 MRFAP1L1 protein protein human Homo sapiens Human MRPLDIDEVEAPEEVEVLEPEEDFEQFLLPVINEMREDIASLIREHGRAYLRTRSKLWEMDNMLIQIKTQVEASEESALNHVQHPSGEADERVSELCEKAEEKAKEIAKMAEMLVELVWRIERSESS This sequence has been withdrawn from Uniprot. 6C914B0B4BEECAE5 q9ubu8-2 Mortality factor 4-like protein 1 MORF4L1 MORF-related gene 15 protein MRG15 Protein MSL3-1 Transcription factor-like protein MRG15 FWP006 HSPC008 HSPC061 PP368 protein protein human Homo sapiens Human MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNLQKQRELQKANQEQYAEGKMRGAAPGKKTSGLQQKNVEVKTKKNKQKTPGNGDGGSTSETPQPPRKKRARVDPTVENEETFMNRVEVKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKKSRGNTDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLNYLHDFLKYLAKNSATLFSASDYEVAPPEYHRKAV mrgbp_human MRG/MORF4L-binding protein MRGBP C20orf20 MRG-binding protein Up-regulated in colon cancer 4 protein protein human Homo sapiens Human MGEAEVGGGGAAGDKGPGEAATSPAEETVVWSPEVEVCLFHAMLGHKPVGVNRHFHMICIRDKFSQNIGRQVPSKVIWDHLSTMYDMQALHESEILPFPNPERNFVLPEEIIQEVREGKVMIEEEMKEEMKEDVDPHNGADDVFSSSGSLGKASEKSSKDKEKNSSDLGCKEGADKRKRSRVTDKVLTANSNPSSPSAAKRRRT mo4l1_human Mortality factor 4-like protein 1 HSPC008 HSPC061 PP368 MORF4L1 MRG15 MORF-related gene 15 protein Transcription factor-like protein MRG15 Protein MSL3-1 FWP006 protein protein human Homo sapiens Human MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKKSAVRPRRSEKSLKTHEDIVALFPVPEGAPSVHHPLLTSSWDEWVPESRVLKYVDTNLQKQRELQKANQEQYAEGKMRGAAPGKKTSGLQQKNVEVKTKKNKQKTPGNGDGGSTSETPQPPRKKRARVDPTVENEETFMNRVEVKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKKSRGNTDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLNYLHDFLKYLAKNSATLFSASDYEVAPPEYHRKAV morf4l1-pam14-1 3140240 N/A 3140243 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3140244 unspecified role unspecified role bait bait Q9UBU8-2:p.Val169Glu V169E mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human direct interaction direct interaction false false false morf4l1-mrgbp-8 3140241 N/A 3140245 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3140244 unspecified role unspecified role bait bait Q9UBU8-2:p.Leu291Ala L291A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human direct interaction direct interaction false false false morf4l1-1 3140242 N/A 3140246 unspecified role unspecified role unspecified role unspecified role Region 151-323 Region 151-323 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli Stoichiometry: 2.0 direct interaction direct interaction false false false