DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ masters-2006-1 in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip protein sequence protein sequence identification protein sequence Masters SL., Yao S., Willson TA., Zhang JG., Palmer KR., Smith BJ., Babon JJ., Nicola NA., Norton RS., Nicholson SE. DIP original experiment: DIP-66090X Nature structural & molecular biology 2006 IMEx The SPRY domain of SSB-2 adopts a novel fold that presents conserved Par-4-binding residues. Masters SL., Yao S., Willson TA., Zhang JG., Palmer KR., Smith BJ., Babon JJ., Nicola NA., Norton RS., Nicholson SE. Only protein-protein interactions imex curation masters-2006-2 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Masters SL., Yao S., Willson TA., Zhang JG., Palmer KR., Smith BJ., Babon JJ., Nicola NA., Norton RS., Nicholson SE. DIP original experiment: DIP-66091X Nature structural & molecular biology 2006 IMEx The SPRY domain of SSB-2 adopts a novel fold that presents conserved Par-4-binding residues. Masters SL., Yao S., Willson TA., Zhang JG., Palmer KR., Smith BJ., Babon JJ., Nicola NA., Norton RS., Nicholson SE. Only protein-protein interactions imex curation masters-2006-3 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Masters SL., Yao S., Willson TA., Zhang JG., Palmer KR., Smith BJ., Babon JJ., Nicola NA., Norton RS., Nicholson SE. DIP original experiment: DIP-66092X Nature structural & molecular biology 2006 IMEx The SPRY domain of SSB-2 adopts a novel fold that presents conserved Par-4-binding residues. Masters SL., Yao S., Willson TA., Zhang JG., Palmer KR., Smith BJ., Babon JJ., Nicola NA., Norton RS., Nicholson SE. Only protein-protein interactions imex curation masters-2006-4 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Masters SL., Yao S., Willson TA., Zhang JG., Palmer KR., Smith BJ., Babon JJ., Nicola NA., Norton RS., Nicholson SE. DIP original experiment: DIP-66093X Nature structural & molecular biology 2006 IMEx The SPRY domain of SSB-2 adopts a novel fold that presents conserved Par-4-binding residues. Masters SL., Yao S., Willson TA., Zhang JG., Palmer KR., Smith BJ., Babon JJ., Nicola NA., Norton RS., Nicholson SE. Only protein-protein interactions imex curation masters-2006-5 human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Masters SL., Yao S., Willson TA., Zhang JG., Palmer KR., Smith BJ., Babon JJ., Nicola NA., Norton RS., Nicholson SE. DIP original experiment: DIP-66094X Nature structural & molecular biology 2006 IMEx The SPRY domain of SSB-2 adopts a novel fold that presents conserved Par-4-binding residues. Masters SL., Yao S., Willson TA., Zhang JG., Palmer KR., Smith BJ., Babon JJ., Nicola NA., Norton RS., Nicholson SE. Only protein-protein interactions imex curation spsb2_mouse SPRY domain-containing SOCS box protein 2 Spsb2 Grcc9 Ssb2 Gene-rich cluster protein C9 protein protein mouse Mus musculus Mouse MGQTALARGSSSTPTSQALYSDFSPPEGLEELLSAPPPDLVAQRHHGWNPKDCSENIDVKEGGLCFERRPVAQSTDGVRGKRGYSRGLHAWEISWPLEQRGTHAVVGVATALAPLQADHYAALLGSNSESWGWDIGRGKLYHQSKGLEAPQYPAGPQGEQLVVPERLLVVLDMEEGTLGYSIGGTYLGPAFRGLKGRTLYPSVSAVWGQCQVRIRYMGERRVEEPQSLLHLSRLCVRHALGDTRLGQISTLPLPPAMKRYLLYK pawr_human PRKC apoptosis WT1 regulator protein Prostate apoptosis response 4 protein PAWR PAR4 protein protein human Homo sapiens Human MATGGYRTSSGLGGSTTDFLEEWKAKREKMRAKQNPPGPAPPGGGSSDAAGKPPAGALGTPAAAAANELNNNLPGGAPAAPAVPGPGGVNCAVGSAMLTRAAPGPRRSEDEPPAASASAAPPPQRDEEEPDGVPEKGKSSGPSARKGKGQIEKRKLREKRRSTGVVNIPAAECLDEYEDDEAGQKERKREDAITQQNTIQNEAVNLLDPGSSYLLQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGFPRYNRDANVSGTLVSSSTLEKKIEDLEKEVVRERQENLRLVRLMQDKEEMIGKLKEEIDLLNRDLDDIEDENEQLKQENKTLLKVVGQLTR spsb1_mouse SPRY domain-containing SOCS box protein 1 Spsb1 Ssb1 protein protein mouse Mus musculus Mouse MGQKVTGGIKTVDMRDPTYRPLKQELQGLDYCKPTRLDLLLDMPPVSYDVQLLHSWNNNDRSLNVFVKEDDKLIFHRHPVAQSTDAIRGKVGYTRGLHVWQITWAMRQRGTHAVVGVATADAPLHSVGYTTLVGNNHESWGWDLGRNRLYHDGKNQPSKTYPAFLEPDETFIVPDSFLVALDMDDGTLSFIVDGQYMGVAFRGLKGKKLYPVVSAVWGHCEIRMRYLNGLDPEPLPLMDLCRRSVRLALGKERLGAIPALPLPASLKAYLLYQ spsb4_mouse SPRY domain-containing SOCS box protein 4 Spsb4 Ssb4 protein protein mouse Mus musculus Mouse MGQKLSGSLKSVEVREPALRPAKRELRGLEPGRPARLDQLLDMPAAGLAVQLRHAWNPEDRSLNVFVKDDDRLTFHRHPVAQSTDGIRGKVGHARGLHAWQIHWPARQRGTHAVVGVATARAPLHSVGYTALVGSDSESWGWDLGRSRLYHDGKNRPGVAYPAFLGPDEAFALPDSLLVVLDMDEGTLSFIVDGQYLGVAFRGLKGKKLYPVVSAVWGHCEVTMRYINGLDPEPLPLMDLCRRSIRSALGRQRLRDIGSLPLPQSLKNYLQYQ met_human Hepatocyte growth factor receptor MET Scatter factor receptor HGF/SF receptor Tyrosine-protein kinase Met Proto-oncogene c-Met protein protein human Homo sapiens Human MKAPAVLAPGILVLLFTLVQRSNGECKEALAKSEMNVNMKYQLPNFTAETPIQNVILHEHHIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMALVVDTYYDDQLISCGSVNRGTCQRHVFPHNHTADIQSEVHCIFSPQIEEPSQCPDCVVSALGAKVLSSVKDRFINFFVGNTINSSYFPDHPLHSISVRRLKETKDGFMFLTDQSYIDVLPEFRDSYPIKYVHAFESNNFIYFLTVQRETLDAQTFHTRIIRFCSINSGLHSYMEMPLECILTEKRKKRSTKKEVFNILQAAYVSKPGAQLARQIGASLNDDILFGVFAQSKPDSAEPMDRSAMCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEARRDEYRTEFTTALQRVDLFMGQFSEVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGPSTPHVNFLLDSHPVSPEVIVEHTLNQNGYTLVITGKKITKIPLNGLGCRHFQSCSQCLSAPPFVQCGWCHDKCVRSEECLSGTWTQQICLPAIYKVFPNSAPLEGGTRLTICGWDFGFRRNNKFDLKKTRVLLGNESCTLTLSESTMNTLKCTVGPAMNKHFNMSIIISNGHGTTQYSTFSYVDPVITSISPKYGPMAGGTLLTLTGNYLNSGNSRHISIGGKTCTLKSVSNSILECYTPAQTISTEFAVKLKIDLANRETSIFSYREDPIVYEIHPTKSFISGGSTITGVGKNLNSVSVPRMVINVHEAGRNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFFMLDGILSKYFDLIYVHNPVFKPFEKPVMISMGNENVLEIKGNDIDPEAVKGEVLKVGNKSCENIHLHSEAVLCTVPNDLLKLNSELNIEWKQAISSTVLGKVIVQPDQNFTGLIAGVVSISTALLLLLGFFLWLKKRKQIKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGSCRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHFNEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNVLSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCWHPKAEMRPSFSELVSRISAIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSEDNADDEVDTRPASFWETS spsb2-pawr-1 3139973 N/A 3139978 unspecified role unspecified role bait bait 1-221 binding region 1-221 binding region sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3139979 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association false false false spsb1-pawr-1 3139974 N/A 3139979 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3139980 unspecified role unspecified role bait bait 1-231 1-231 sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain false FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false spsb4-pawr-1 3139975 N/A 3139979 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3139981 unspecified role unspecified role bait bait 1-233 binding site 1-233 binding site sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false spsb2-pawr-2 3139976 N/A 3139979 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3139978 unspecified role unspecified role bait bait 1-221 binding region 1-221 binding region sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain false O88838:p.Tyr120Ala Y120A mutation mutation disrupting mutation disrupting interaction mutation disrupting full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain false O88838:p.Leu123_Gly125delinsAlaAlaAla L123A,L124A,G125A mutation mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain false O88838:p.Tyr141_Gln143delinsAlaAlaAla Y141A,H142A,Q143A mutation mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain false O88838:p.Gln151_Tyr152delinsAlaAla Q151A, Y152A mutation mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain false O88838:p.Gly188_Pro189delinsAlaAla G188A, P189A mutation mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain false O88838:p.Val206Ala V206A mutation mutation disrupting mutation disrupting interaction mutation disrupting full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain false FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged full dna sequence full identification by DNA sequencing full dna sequence n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human physical association physical association false false false met-spsb2-1 3139977 N/A 3139982 unspecified role unspecified role bait bait human Homo sapiens Human N/A 3139978 unspecified role unspecified role prey prey FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged full dna sequence full identification by DNA sequencing full dna sequence n-term range n-terminal range n-term range n-term range n-terminal range n-term range false O88838:p.Leu123_Gly125delinsAlaAlaAla L123A,L124A,G125A mutation mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain false O88838:p.Tyr141_Gln143delinsAlaAlaAla Y141A,H142A,Q143A mutation mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain false O88838:p.Gln151_Tyr152delinsAlaAla Q151A, Y152A mutation mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain false O88838:p.Gly188_Pro189delinsAlaAla G188A, P189A mutation mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false