DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ she-2006-1 in vitro In vitro pull down pull down predetermined predetermined participant predetermined She M., Decker CJ., Chen N., Tumati S., Parker R., Song H. DIP original experiment: DIP-66100X Nature structural & molecular biology 2006 IMEx Crystal structure and functional analysis of Dcp2p from Schizosaccharomyces pombe. She M., Decker CJ., Chen N., Tumati S., Parker R., Song H. Only protein-protein interactions imex curation she-2006-2 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined She M., Decker CJ., Chen N., Tumati S., Parker R., Song H. DIP original experiment: DIP-66101X Nature structural & molecular biology 2006 IMEx Crystal structure and functional analysis of Dcp2p from Schizosaccharomyces pombe. She M., Decker CJ., Chen N., Tumati S., Parker R., Song H. Only protein-protein interactions imex curation she-2006-3 in vitro In vitro dls dynamic light scattering dls predetermined predetermined participant predetermined She M., Decker CJ., Chen N., Tumati S., Parker R., Song H. DIP original experiment: DIP-66102X Nature structural & molecular biology 2006 IMEx Crystal structure and functional analysis of Dcp2p from Schizosaccharomyces pombe. She M., Decker CJ., Chen N., Tumati S., Parker R., Song H. Only protein-protein interactions imex curation she-2006-4 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast two hybrid array two hybrid array predetermined predetermined participant predetermined She M., Decker CJ., Chen N., Tumati S., Parker R., Song H. DIP original experiment: DIP-66103X Nature structural & molecular biology 2006 IMEx Crystal structure and functional analysis of Dcp2p from Schizosaccharomyces pombe. She M., Decker CJ., Chen N., Tumati S., Parker R., Song H. Only protein-protein interactions imex curation she-2006-5 in vitro In vitro pull down pull down predetermined predetermined participant predetermined She M., Decker CJ., Chen N., Tumati S., Parker R., Song H. DIP original experiment: DIP-66099X Nature structural & molecular biology 2006 IMEx Crystal structure and functional analysis of Dcp2p from Schizosaccharomyces pombe. She M., Decker CJ., Chen N., Tumati S., Parker R., Song H. Only protein-protein interactions imex curation dcp2_schpo mRNA decapping complex subunit 2 dcp2 SPAC19A8.12 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSFTNATFSQVLDDLSARFILNLPAEEQSSVERLCFQIEQAHWFYEDFIRAQNDQLPSLGLRVFSAKLFAHCPLLWKWSKVHEEAFDDFLRYKTRIPVRGAIMLDMSMQQCVLVKGWKASSGWGFPKGKIDKDESDVDCAIREVYEETGFDCSSRINPNEFIDMTIRGQNVRLYIIPGISLDTRFESRTRKEISKIEWHNLMDLPTFKKNKPQTMKNKFYMVIPFLAPLKKWIKKRNIANNTTKEKNISVDVDADASSQLLSLLKSSTAPSDLATPQPSTFPQPPVESHSSFDIKQKILHLLNEGNEPKSPIQLPPVSNLPLNPPIQSSNSRLSHDNNSFDPFAYLGLDPKNPSASFPRVVSQNNMLTNKPVLNNHFQQSMYSNLLKDQNSVQHLFAASDMPSPMELPSPSTVYHQVFYPPTSTSVSSYGLGKTPQPAYGSSSPYVNGHQTQQISSLPPFQSQTQFLARNSDNSGQSYNSEGDSNSKRLLSMLSQQDTTPSSSTLSKEANVQLANLFLTPNSLETKKFSDNSQGEEISDNLHGESCNNPNANSVHSAQLLQALLHPSATETKEETPKKTSDSLSLLTLLKSGLPTPANDLQNKSQNNERKASSQVKELEVKNYSKSTDLLKKTLRIPRNDEPLEAANQFDLLKVSPQQKSEVPPKRNELSQSKLKNRKKKENSETNKNHVDMSPGFVKILKRSPLADQKKEDTQESDFKGSDDHFLSYLQSVVSSNSNGLH B405257B706BC5C0 dcp1_schpo mRNA-decapping enzyme subunit 1 dcp1 SPBC3B9.21 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MEDENILRNAVNLQVLKFHYPEIESIIDIASHVAVYQFDVGSQKWLKTSIEGTFFLVKDQRARVGYVILNRNSPENLYLFINHPSNVHLVDRYLIHRTENQHVVGLWMFDPNDMSRIFNIVKESLLR DD593F646C61EEC0 mint dcp2_yeast m7GpppN-mRNA hydrolase DCP2 Protein PSU1 PSU1 mRNA-decapping enzyme subunit 2 N1917 YNL118C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSLPLRHALENVTSVDRILEDLLVRFIINCPNEDLSSVERELFHFEEASWFYTDFIKLMNPTLPSLKIKSFAQLIIKLCPLVWKWDIRVDEALQQFSKYKKSIPVRGAAIFNENLSKILLVQGTESDSWSFPRGKISKDENDIDCCIREVKEEIGFDLTDYIDDNQFIERNIQGKNYKIFLISGVSEVFNFKPQVRNEIDKIEWFDFKKISKTMYKSNIKYYLINSMMRPLSMWLRHQRQIKNEDQLKSYAEEQLKLLLGITKEEQIDPGRELLNMLHTAVQANSNNNAVSNGQVPSSQELQHLKEQSGEHNQQKDQQSSFSSQQQPSIFPSLSEPFANNKNVIPPTMPMANVFMSNPQLFATMNGQPFAPFPFMLPLTNNSNSANPIPTPVPPNFNAPPNPMAFGVPNMHNLSGPAVSQPFSLPPAPLPRDSGYSSSSPGQLLDILNSKKPDSNVQSSKKPKLKILQRGTDLNSIKQNNNDETAHSNSQALLDLLKKPTSSQKIHASKPDTSFLPNDSVSGIQDAEYEDFESSSDEEVETARDERNSLNVDIGVNVMPSEKDSRRSQKEKPRNDASKTNLNASAESNSVEWGPGKSSPSTQSKQNSSVGMQNKYRQEIHIGDSDAYEVFESSSDEEDGKKLEELEQTQDNSKLISQDILKENNFQDGEVPHRDMPTESNKSINETVGLSSTTNTVKKVPKVKILKRGETFASLANDKKAFDSSSNVSSSKDLLQMLRNPISSTVSSNQQSPKSQHLSGDEEIMMMLKRNSVSKPQNSEENASTSSINDANASELLGMLKQKEKDITAPKQPYNVDSYSQKNSAKGLLNILKKNDSTGYPRTEGGPSSEMSTSMKRNDATNNQELDKNSTELLNYLKPKPLNDGYENISNKDSSHELLNILHGNKNSSAFNNNVYATDGYSLASDNNENSSNKLLNMLQNRSSAINEPNFDVRSNGTSGSNELLSILHRK D53CA2C5A546FA4A dcp1_yeast mRNA-decapping enzyme subunit 1 DCP1 YOL149W protein protein yeast Saccharomyces cerevisiae Baker's yeast MTGAATAAENSATQLEFYRKALNFNVIGRYDPKIKQLLFHTPHASLYKWDFKKDEWNKLEYQGVLAIYLRDVSQNTNLLPVSPQEVDIFDSQNGSNNIQVNNGSDNSNRNSSGNGNSYKSNDSLTYNCGKTLSGKDIYNYGLIILNRINPDNFSMGIVPNSVVNKRKVFNAEEDTLNPLECMGVEVKDELVIIKNLKHEVYGIWIHTVSDRQNIYELIKYLLENEPKDSFA 8456B1C96C121C4D spdcp1p-spdcp2p-1 3139934 N/A 3139939 unspecified role unspecified role prey prey 18 binding site 18 binding site required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false 19 binding site 19 binding site required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false 44 binding site 44 binding site required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3139940 unspecified role unspecified role bait bait GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli direct interaction direct interaction false false false spdcp1p-spdcp2p-2 3139935 N/A 3139939 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli N/A 3139940 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli direct interaction direct interaction false false false spdcp1p-spdcp2p-3 3139936 N/A 3139939 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli N/A 3139940 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli direct interaction direct interaction false false false scdcp1p-scdcp2p-1 3139937 N/A 3139941 unspecified role unspecified role prey prey 25 binding site 25 binding site required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false 26 binding site 26 binding site required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false 51 binding site 51 binding site required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3139942 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false spdcp2p-spdcp1p-1 3139938 N/A 3139939 unspecified role unspecified role bait bait 1-95 binding region 1-95 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag full dna sequence full identification by DNA sequencing full dna sequence undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli N/A 3139940 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false