DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ lao_sirieix-2005-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lao-Sirieix SH., Nookala RK., Roversi P., Bell SD., Pellegrini L. DIP original experiment: DIP-254814X Nature structural & molecular biology 2005 IMEx Structure of the heterodimeric core primase. Lao-Sirieix SH., Nookala RK., Roversi P., Bell SD., Pellegrini L. Only protein-protein interactions imex curation lao_sirieix-2005-2 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Lao-Sirieix SH., Nookala RK., Roversi P., Bell SD., Pellegrini L. DIP original experiment: DIP-254812X Nature structural & molecular biology 2005 IMEx Structure of the heterodimeric core primase. Lao-Sirieix SH., Nookala RK., Roversi P., Bell SD., Pellegrini L. Only protein-protein interactions imex curation lao_sirieix-2005-3 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lao-Sirieix SH., Nookala RK., Roversi P., Bell SD., Pellegrini L. DIP original experiment: DIP-254813X Nature structural & molecular biology 2005 IMEx Structure of the heterodimeric core primase. Lao-Sirieix SH., Nookala RK., Roversi P., Bell SD., Pellegrini L. Only protein-protein interactions imex curation pril_sacs2 DNA primase large subunit PriL priL priB C21_042 SSO0557 protein protein sulso Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) MALDVKKYPFIKSLDDELKKYGGGITLTDLLLNSTTLIDQAKDRIQKTKSGDELPHYVSYNEPVLVFYTTLLSLAILNDVKLIRRYAYAEAKQFRSLLHTENEENLLEISKLLDLKINRCDPIKFYLEKKRRIIQKEFCVHFIDYLKYTKDLKEDWKLSGQILHKGYVYLDKNQLIGLIAESIKSKIVEMIRPLNLKEIPEKLKSLIERRGIIPPCIENILAKEKLNEEEIRTLITFYIDIGKGLSGIVSIMKKYNVSNVEDLYRKYRGDKGTRYIVYSCAKMKQLGLCVSSCNVKNPLQLYFLSNE mint DNA primase is the polymerase that synthesizes small RNA primers for the Okazaki fragments on both template strands at replication forks during chromosomal DNA synthesis pris_sacs2 DNA primase small subunit PriS priS priA SSO1048 protein protein sulso Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) MGTFTLHQGQTNLIKSFFRNYYLNAELELPKDMELREFALQPFGSDTYVRHLSFSSSEELRDYLVNRNLPLHLFYSSARYQLPSARNMEEKAWMGSDLLFDIDADHLCKLRSIRFCPVCGNAVVSEKCERDNVETLEYVEMTSECIKRGLEQTRNLVEILEDDFGLKPKVYFSGNRGFHVQVDCYGNCALLDSDERKEIAEYVMGIGVPGYPGGSENAPGWVGRKNRGINGVTIDEQVTIDVKRLIRIPNSLHGKSGLIVKRVPNLDDFEFNETLSPFTGYTIFLPYITIETEVLGSIIKLNRGIPIKIKSSIGIYLHLRNLGEVKAYVR mint DNA primase is the polymerase that synthesizes small RNA primers for the Okazaki fragments on both template strands at replication forks during chromosomal DNA synthesis pril-pris-1 3139367 N/A 3139370 unspecified role unspecified role bait bait Q9UWW1:p.[Phe142Glu;Leu163Glu] F142E/L163E mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3139371 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false pril-pris-2 3139368 N/A 3139370 unspecified role unspecified role unspecified role unspecified role Region 1-212 Region 1-212 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3139371 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false pril-pris-3 3139369 N/A 3139370 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3139371 unspecified role unspecified role prey prey Q97Z83:p.Gly165Ile G165I mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q97Z83:p.Phe164Glu F164E mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Q97Z83:p.[Phe164Gly;Ile199Lys] F164G/I199K mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false